You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSolute carrier family 22 member 20
Synonyms
  • OAT6
  • Organic anion transporter 6
Gene NameSLC22A20
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009298|Solute carrier family 22 member 20
MAFTDLLDALGSMGRFQLNHTALLLLPCGLLACHNFLQNFTAAVPPHHCRGPANHTEAST
NDSGAWLRATIPLDQLGAPEPCRRFTKPQWALLSPNSSIPGAATEGCKDGWVYNRSVFPS
TIVMEWDLVCEARTLRDLAQSVYMAGVLVGAAVFGSLADRLGCKGPLVWSYLQLAASGAA
TAYFSSFSAYCVFRFLMGMTFSGIILNSVSLVVEWMPTRGRTVAGILLGYSFTLGQLILA
GVAYLIRPWRCLQFAISAPFLIFFLYSWWLPESSRWLLLHGKSQLAVQNLQKVAAMNGRK
EEGERLTKEVMSSYIQSEFASVCTSNSILDLFRTPAIRKVTCCLMVIWFSNSVAYYGLAM
DLQKFGLSLYLVQALFGIINTPAMLVATATMIYVGRRATVASFLILAGLMVIANMFVPEG
TQILCTAQAALGKGCLASSFICVYLFTGELYPTEIRQMGMGFASVHARLGGLTAPLVTTL
GEYSTILPPVSFGATAILAGLAVCVLTETRNMPLVETIAAMERRVKEGSSKKHVEEKSEE
ISLQQLRASPLKETI
Number of residues555
Molecular Weight60458.14
Theoretical pINot Available
GO Classification
Functions
  • inorganic anion exchanger activity
  • sodium-independent organic anion transmembrane transporter activity
Processes
  • sodium-independent organic anion transport
  • anion transmembrane transport
Components
  • integral component of plasma membrane
General FunctionSodium-independent organic anion transmembrane transporter activity
Specific FunctionOrganic anion transporter that mediates the uptake of estrone sulfate. Inhibited by probenecid, propionate, 2-methylbutyrate, 3-methylbutyrate, benzoate, heptanoate and 2-ethylhaxanoate. May act as an odorant transporter (By similarity).
Pfam Domain Function
Transmembrane Regions24-44 138-158 167-187 195-215 226-246 251-271 340-360 374-394 398-418 430-450 486-506
GenBank Protein IDNot Available
UniProtKB IDA6NK97
UniProtKB Entry NameS22AK_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0020874|Solute carrier family 22 member 20 (SLC22A20)
ATGGCCATGGCCTTCACAGACCTGCTGGATGCTCTGGGCAGCATGGGCCGCTTCCAGCTC
AACCACACAGCCCTGCTGCTGCTGCCCTGCGGCCTGCTGGCCTGCCACAACTTCCTGCAG
AACTTCACGGCCGCTGTCCCCCCCCACCACTGCCGGGGCCCTGCCAACCACACTGAGGCC
TCCACCAACGACTCGGGGGCCTGGCTGAGGGCCACCATACCCCTGGACCAGCTTGGGGCC
CCTGAGCCCTGCCGGCGCTTCACCAAGCCTCAGTGGGCCCTGCTGAGCCCCAACTCCTCC
ATCCCGGGCGCGGCCACGGAGGGCTGCAAGGACGGCTGGGTCTATAACCGCAGTGTTTTC
CCGTCCACCATCGTGATGGAGTGGGATCTGGTGTGTGAGGCCCGCACTCTCCGAGACCTG
GCGCAGTCCGTCTACATGGCCGGGGTGCTGGTGGGGGCTGCCGTGTTTGGCAGCTTGGCA
GACAGGCTGGGCTGCAAGGGCCCCCTGGTCTGGTCCTACCTGCAGCTGGCAGCTTCGGGG
GCCGCCACAGCGTATTTCAGCTCCTTCAGTGCCTATTGCGTCTTCCGGTTCCTGATGGGC
ATGACCTTCTCTGGCATCATCCTCAACTCCGTCTCCCTGGTGGCTTCCAGAGTCATCCCG
CTGGCTCCTCCTGCATGGCAAGTCCCAGTTAGCTGTACAGAATCTGCAGAAGGTGGCTGC
AATGAACGGGAGGAAGGAGGAAGGGGAAAGGCTGACCAAGGAGGTGATGAGCTCCTACAT
CCAAAGCGAGTTTGCAAGTGTCTGCACCTCCAACTCAATCTTGGACCTCTTCCGAACCCC
GGCCATCCGCAAGGTCACATGCTGTCTCATGGTGATTTGCGTGGCAGGCAGCGCAGTTCC
GGCTCTGGGGAGCAAGGGGGCTCCTGCGAACCCGAGTCCAGGAATGGGCGTCTTCCTGCG
GTAGCCCCTGCCGGCCTGGGCTTGCCCTTCGTCCACCTTCCTCTTTCCGCGAGGGAGAAA
CAGATCCTGAGTTCAAAATTCCAGAGCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:29867
Chromosome Location11
LocusNot Available
References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. 16554811
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334