You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameCalcium-activated chloride channel regulator 1
Synonyms
  • 3.4.-.-
  • CaCC-1
  • CACC1
  • Calcium-activated chloride channel family member 1
  • Calcium-activated chloride channel protein 1
  • hCaCC-1
  • hCLCA1
Gene NameCLCA1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013969|Calcium-activated chloride channel regulator 1
MGPFKSSVFILILHLLEGALSNSLIQLNNNGYEGIVVAIDPNVPEDETLIQQIKDMVTQA
SLYLLEATGKRFYFKNVAILIPETWKTKADYVRPKLETYKNADVLVAESTPPGNDEPYTE
QMGNCGEKGERIHLTPDFIAGKKLAEYGPQGRAFVHEWAHLRWGVFDEYNNDEKFYLSNG
RIQAVRCSAGITGTNVVKKCQGGSCYTKRCTFNKVTGLYEKGCEFVLQSRQTEKASIMFA
QHVDSIVEFCTEQNHNKEAPNKQNQKCNLRSTWEVIRDSEDFKKTTPMTTQPPNPTFSLL
QIGQRIVCLVLDKSGSMATGNRLNRLNQAGQLFLLQTVELGSWVGMVTFDSAAHVQNELI
QINSGSDRDTLAKRLPAAASGGTSICSGLRSAFTVIRKKYPTDGSEIVLLTDGEDNTISG
CFNEVKQSGAIIHTVALGPSAAQELEELSKMTGGLQTYASDQVQNNGLIDAFGALSSGNG
AVSQRSIQLESKGLTLQNSQWMNGTVIVDSTVGKDTLFLITWTMQPPQILLWDPSGQKQG
GFVVDKNTKMAYLQIPGIAKVGTWKYSLQASSQTLTLTVTSRASNATLPPITVTSKTNKD
TSKFPSPLVVYANIRQGASPILRASVTALIESVNGKTVTLELLDNGAGADATKDDGVYSR
YFTTYDTNGRYSVKVRALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNPPRPEINKDD
VQHKQVCFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAPGDDY
DHGTAHKYIIRISTSILDLRDKFNESLQVNTTALIPKEANSEEVFLFKPENITFENGTDL
FIAIQAVDKVDLKSEISNIARVSLFIPPQTPPETPSPDETSAPCPNIHINSTIPGIHILK
IMWKWIGELQLSIA
Number of residues914
Molecular Weight100224.765
Theoretical pINot Available
GO Classification
Functions
  • intracellular calcium activated chloride channel activity
  • chloride channel activity
  • metallopeptidase activity
  • metal ion binding
Processes
  • chloride transmembrane transport
  • transport
  • calcium ion transport
  • chloride transport
  • transmembrane transport
  • ion transmembrane transport
Components
  • microvillus
  • plasma membrane
  • extracellular space
  • integral component of plasma membrane
  • secretory granule
General FunctionMetallopeptidase activity
Specific FunctionMay be involved in mediating calcium-activated chloride conductance. May play critical roles in goblet cell metaplasia, mucus hypersecretion, cystic fibrosis and AHR. May be involved in the regulation of mucus production and/or secretion by goblet cells. Involved in the regulation of tissue inflammation in the innate immune response. May play a role as a tumor suppressor. Induces MUC5AC.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDA8K7I4
UniProtKB Entry NameCLCA1_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0013970|Calcium-activated chloride channel regulator 1 (CLCA1)
ATGGGGCCATTTAAGAGTTCTGTGTTCATCTTGATTCTTCACCTTCTAGAAGGGGCCCTG
AGTAATTCACTCATTCAGCTGAACAACAATGGCTATGAAGGCATTGTCGTTGCAATCGAC
CCCAATGTGCCAGAAGATGAAACACTCATTCAACAAATAAAGGACATGGTGACCCAGGCA
TCTCTGTATCTGTTTGAAGCTACAGGAAAGCGATTTTATTTCAAAAATGTTGCCATTTTG
ATTCCTGAAACATGGAAGACAAAGGCTGACTATGTGAGACCAAAACTTGAGACCTACAAA
AATGCTGATGTTCTGGTTGCTGAGTCTACTCCTCCAGGTAATGATGAACCCTACACTGAG
CAGATGGGCAACTGTGGAGAGAAGGGTGAAAGGATCCACCTCACTCCTGATTTCATTGCA
GGAAAAAAGTTAGCTGAATATGGACCACAAGGTAGGGCATTTGTCCATGAGTGGGCTCAT
CTACGATGGGGAGTATTTGACGAGTACAATAATGATGAGAAATTCTACTTATCCAATGGA
AGAATACAAGCAGTAAGATGTTCAGCAGGTATTACTGGTACAAATGTAGTAAAGAAGTGT
CAGGGAGGCAGCTGTTACACCAAAAGATGCACATTCAATAAAGTAACAGGACTCTATGAA
AAAGGATGTGAGTTTGTTCTCCAATCCCGCCAGACGGAGAAGGCTTCTATAATGTTTGCA
CAACATGTTGATTCTATAGTTGAATTCTGTACAGAACAAAACCACAACAAAGAAGCTCCA
AACAAGCAAAATCAAAAATGCAATCTCCGAAGCACATGGGAAGTGATCCGTGATTCTGAG
GACTTTAAGAAAACCACTCCTATGACAACACAGCCACCAAATCCCACCTTCTCATTGCTG
CAGATTGGACAAAGAATTGTGTGTTTAGTCCTTGACAAATCTGGAAGCATGGCGACTGGT
AACCGCCTCAATCGACTGAATCAAGCAGGCCAGCTTTTCCTGCTGCAGACAGTTGAGCTG
GGGTCCTGGGTTGGGATGGTGACATTTGACAGTGCTGCCCATGTACAAAATGAACTCATA
CAGATAAACAGTGGCAGTGACAGGGACACACTCGCCAAAAGATTACCTGCAGCAGCTTCA
GGAGGGACGTCCATCTGCAGCGGGCTTCGATCGGCATTTACTGTGATTAGGAAGAAATAT
CCAACTGATGGATCTGAAATTGTGCTGCTGACGGATGGGGAAGACAACACTATAAGTGGG
TGCTTTAACGAGGTCAAACAAAGTGGTGCCATCATCCACACAGTCGCTTTGGGGCCCTCT
GCAGCTCAAGAACTAGAGGAGCTGTCCAAAATGACAGGAGGTTTACAGACATATGCTTCA
GATCAAGTTCAGAACAATGGCCTCATTGATGCTTTTGGGGCCCTTTCATCAGGAAATGGA
GCTGTCTCTCAGCGCTCCATCCAGCTTGAGAGTAAGGGATTAACCCTCCAGAACAGCCAG
TGGATGAATGGCACAGTGATCGTGGACAGCACCGTGGGAAAGGACACTTTGTTTCTTATC
ACCTGGACAATGCAGCCTCCCCAAATCCTTCTCTGGGATCCCAGTGGACAGAAGCAAGGT
GGCTTTGTAGTGGACAAAAACACCAAAATGGCCTACCTCCAAATCCCAGGCATTGCTAAG
GTTGGCACTTGGAAATACAGTCTGCAAGCAAGCTCACAAACCTTGACCCTGACTGTCACG
TCCCGTGCGTCCAATGCTACCCTGCCTCCAATTACAGTGACTTCCAAAACGAACAAGGAC
ACCAGCAAATTCCCCAGCCCTCTGGTAGTTTATGCAAATATTCGCCAAGGAGCCTCCCCA
ATTCTCAGGGCCAGTGTCACAGCCCTGATTGAATCAGTGAATGGAAAAACAGTTACCTTG
GAACTACTGGATAATGGAGCAGGTGCTGATGCTACTAAGGATGACGGTGTCTACTCAAGG
TATTTCACAACTTATGACACGAATGGTAGATACAGTGTAAAAGTGCGGGCTCTGGGAGGA
GTTAACGCAGCCAGACGGAGAGTGATACCCCAGCAGAGTGGAGCACTGTACATACCTGGC
TGGATTGAGAATGATGAAATACAATGGAATCCACCAAGACCTGAAATTAATAAGGATGAT
GTTCAACACAAGCAAGTGTGTTTCAGCAGAACATCCTCGGGAGGCTCATTTGTGGCTTCT
GATGTCCCAAATGCTCCCATACCTGATCTCTTCCCACCTGGCCAAATCACCGACCTGAAG
GCGGAAATTCACGGGGGCAGTCTCATTAATCTGACTTGGACAGCTCCTGGGGATGATTAT
GACCATGGAACAGCTCACAAGTATATCATTCGAATAAGTACAAGTATTCTTGATCTCAGA
GACAAGTTCAATGAATCTCTTCAAGTGAATACTACTGCTCTCATCCCAAAGGAAGCCAAC
TCTGAGGAAGTCTTTTTGTTTAAACCAGAAAACATTACTTTTGAAAATGGCACAGATCTT
TTCATTGCTATTCAGGCTGTTGATAAGGTCGATCTGAAATCAGAAATATCCAACATTGCA
CGAGTATCTTTGTTTATTCCTCCACAGACTCCGCCAGAGACACCTAGTCCTGATGAAACG
TCTGCTCCTTGTCCTAATATTCATATCAACAGCACCATTCCTGGCATTCACATTTTAAAA
ATTATGTGGAAGTGGATAGGAGAACTGCAGCTGTCAATAGCCTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:2015
Chromosome Location1
LocusNot Available
References
  1. Gruber AD, Elble RC, Ji HL, Schreur KD, Fuller CM, Pauli BU: Genomic cloning, molecular characterization, and functional analysis of human CLCA1, the first human member of the family of Ca2+-activated Cl- channel proteins. Genomics. 1998 Dec 1;54(2):200-14. 9828122
  2. Agnel M, Vermat T, Culouscou JM: Identification of three novel members of the calcium-dependent chloride channel (CaCC) family predominantly expressed in the digestive tract and trachea. FEBS Lett. 1999 Jul 23;455(3):295-301. 10437792
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  5. Yurtsever Z, Sala-Rabanal M, Randolph DT, Scheaffer SM, Roswit WT, Alevy YG, Patel AC, Heier RF, Romero AG, Nichols CG, Holtzman MJ, Brett TJ: Self-cleavage of human CLCA1 protein by a novel internal metalloprotease domain controls calcium-activated chloride channel activation. J Biol Chem. 2012 Dec 7;287(50):42138-49. doi: 10.1074/jbc.M112.410282. Epub 2012 Oct 30. 23112050
  6. Bustin SA, Li SR, Dorudi S: Expression of the Ca2+-activated chloride channel genes CLCA1 and CLCA2 is downregulated in human colorectal cancer. DNA Cell Biol. 2001 Jun;20(6):331-8. 11445004
  7. Hoshino M, Morita S, Iwashita H, Sagiya Y, Nagi T, Nakanishi A, Ashida Y, Nishimura O, Fujisawa Y, Fujino M: Increased expression of the human Ca2+-activated Cl- channel 1 (CaCC1) gene in the asthmatic airway. Am J Respir Crit Care Med. 2002 Apr 15;165(8):1132-6. 11956057
  8. Toda M, Tulic MK, Levitt RC, Hamid Q: A calcium-activated chloride channel (HCLCA1) is strongly related to IL-9 expression and mucus production in bronchial epithelium of patients with asthma. J Allergy Clin Immunol. 2002 Feb;109(2):246-50. 11842292
  9. Lee SH, Park JH, Jung HH, Lee SH, Oh JW, Lee HM, Jun HS, Cho WJ, Lee JY: Expression and distribution of ion transport mRNAs in human nasal mucosa and nasal polyps. Acta Otolaryngol. 2005 Jul;125(7):745-52. 16012037
  10. Hauber HP, Daigneault P, Frenkiel S, Lavigne F, Hung HL, Levitt RC, Hamid Q: Niflumic acid and MSI-2216 reduce TNF-alpha-induced mucin expression in human airway mucosa. J Allergy Clin Immunol. 2005 Feb;115(2):266-71. 15696080
  11. Gibson A, Lewis AP, Affleck K, Aitken AJ, Meldrum E, Thompson N: hCLCA1 and mCLCA3 are secreted non-integral membrane proteins and therefore are not ion channels. J Biol Chem. 2005 Jul 22;280(29):27205-12. Epub 2005 May 25. 15919655
  12. Thai P, Chen Y, Dolganov G, Wu R: Differential regulation of MUC5AC/Muc5ac and hCLCA-1/mGob-5 expression in airway epithelium. Am J Respir Cell Mol Biol. 2005 Dec;33(6):523-30. Epub 2005 Sep 8. 16151054
  13. Kim YM, Won TB, Kim SW, Min YG, Lee CH, Rhee CS: Histamine induces MUC5AC expression via a hCLCA1 pathway. Pharmacology. 2007;80(4):219-26. Epub 2007 Jul 5. 17622767