Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGamma-aminobutyric acid receptor subunit rho-3
Synonyms
  • GABA(A) receptor subunit rho-3
  • GABA(C) receptor
Gene NameGABRR3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017160|Gamma-aminobutyric acid receptor subunit rho-3
MVLAFQLVSFTYIWIILKPNVCAASNIKMTHQRCSSSMKQTCKQETRMKKDDSTKARPQK
YEQLLHIEDNDFAMRPGFGGSPVPVGIDVHVESIDSISETNMDFTMTFYLRHYWKDERLS
FPSTANKSMTFDHRLTRKIWVPDIFFVHSKRSFIHDTTMENIMLRVHPDGNVLLSLRITV
SAMCFMDFSRFPLDTQNCSLELESYAYNEDDLMLYWKHGNKSLNTEEHMSLSQFFIEDFS
ASSGLAFYSSTGWYNRLFINFVLRRHVFFFVLQTYFPAILMVMLSWVSFWIDRRAVPARV
SLGITTVLTMSTIITAVSASMPQVSYLKAVDVYLWVSSLFVFLSVIEYAAVNYLTTVEER
KQFKKTGKISRMYNIDAVQAMAFDGCYHDSEIDMDQTSLSLNSEDFMRRKSICSPSTDSS
RIKRRKSLGGHVGRIILENNHVIDTYSRILFPIVYILFNLFYWGVYV
Number of residues467
Molecular Weight54271.1
Theoretical pI8.26
GO Classification
Functions
  • GABA-A receptor activity
  • extracellular ligand-gated ion channel activity
  • chloride channel activity
Processes
  • gamma-aminobutyric acid signaling pathway
  • synaptic transmission
  • transmembrane transport
  • ion transmembrane transport
Components
  • plasma membrane
  • cell junction
  • chloride channel complex
  • postsynaptic membrane
General FunctionGaba-a receptor activity
Specific FunctionGABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
Pfam Domain Function
Transmembrane Regions267-287 300-320 332-352 447-467
GenBank Protein IDNot Available
UniProtKB IDA8MPY1
UniProtKB Entry NameGBRR3_HUMAN
Cellular LocationCell junction
Gene sequence
>lcl|BSEQ0017161|Gamma-aminobutyric acid receptor subunit rho-3 (GABRR3)
ATGGTCCTGGCTTTCCAGTTAGTCTCCTTCACCTACATCTGGATCATATTGAAACCAAAT
GTTTGTGCTGCTTCTAACATCAAGATGACACACCAGCGGTGCTCCTCTTCAATGAAACAA
ACCTGCAAACAAGAAACTAGAATGAAGAAAGATGACAGTACCAAAGCGCGGCCTCAGAAA
TATGAGCAACTTCTCCATATAGAGGACAACGATTTCGCAATGAGACCTGGATTTGGAGGG
TCTCCAGTGCCAGTAGGTATAGATGTCCATGTTGAAAGCATTGACAGCATTTCAGAGACT
AACATGGACTTTACAATGACTTTTTATCTCAGGCATTACTGGAAAGACGAGAGGCTCTCC
TTTCCTAGCACAGCAAACAAAAGCATGACATTTGATCATAGATTGACCAGAAAGATCTGG
GTGCCTGATATCTTTTTTGTCCACTCTAAAAGATCCTTCATCCATGATACAACTATGGAG
AATATCATGCTGCGCGTACACCCTGATGGAAACGTCCTCCTAAGTCTCAGGATAACGGTT
TCGGCCATGTGCTTTATGGATTTCAGCAGGTTTCCTCTTGACACTCAAAATTGTTCTCTT
GAACTGGAAAGCTATGCCTACAATGAGGATGACCTAATGCTATACTGGAAACACGGAAAC
AAGTCCTTAAATACTGAAGAACATATGTCCCTTTCTCAGTTCTTCATTGAAGACTTCAGT
GCATCTAGTGGATTAGCTTTCTATAGCAGCACAGGTTGGTACAATAGGCTTTTCATCAAC
TTTGTGCTAAGGAGGCATGTTTTCTTCTTTGTGCTGCAAACCTATTTCCCAGCCATATTG
ATGGTGATGCTTTCATGGGTTTCATTTTGGATTGACCGAAGAGCTGTTCCTGCAAGAGTT
TCCCTGGGAATCACCACAGTGCTGACCATGTCCACAATCATCACTGCTGTGAGCGCCTCC
ATGCCCCAGGTGTCCTACCTCAAGGCTGTGGATGTGTACCTGTGGGTCAGCTCCCTCTTT
GTGTTCCTGTCAGTCATTGAGTATGCAGCTGTGAACTACCTCACCACAGTGGAAGAGCGG
AAACAATTCAAGAAGACAGGAAAGATTTCTAGGATGTACAATATTGATGCAGTTCAAGCT
ATGGCCTTTGATGGTTGTTACCATGACAGCGAGATTGACATGGACCAGACTTCCCTCTCT
CTAAACTCAGAAGACTTCATGAGAAGAAAATCGATATGCAGCCCCAGCACCGATTCATCT
CGGATAAAGAGAAGAAAATCCCTAGGAGGACATGTTGGTAGAATCATTCTGGAAAACAAC
CATGTCATTGACACCTATTCTAGGATTTTATTCCCCATTGTGTATATTTTATTTAATTTG
TTTTACTGGGGTGTATATGTATGA
GenBank Gene IDAC026100
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:17969
Chromosome Location3
Locus3q11.2
References
  1. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. 16641997
  2. Bailey ME, Albrecht BE, Johnson KJ, Darlison MG: Genetic linkage and radiation hybrid mapping of the three human GABA(C) receptor rho subunit genes: GABRR1, GABRR2 and GABRR3. Biochim Biophys Acta. 1999 Oct 28;1447(2-3):307-12. 10542332