Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameCocaine esterase
Synonyms
  • 3.1.1.84
  • Carboxylesterase 2
  • CE-2
  • hCE-2
  • ICE
  • Methylumbelliferyl-acetate deacetylase 2
Gene NameCES2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008563|Cocaine esterase
MRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLG
IPFAKPPLGPLRFAPPEPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMS
EDCLYLSIYTPAHSHEGSNLPVMVWIHGGALVFGMASLYDGSMLAALENVVVVIIQYRLG
VLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFGGNPDRVTIFGESAGGTSVSSLVVS
PISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSACDQVDSEALVGCLRGKSKEEI
LAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRIYDTQ
KEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPA
LQVAHFQCSRAPVYFYEFQHQPSWLKNIRPPHMKADHGDELPFVFRSFFGGNYIKFTEEE
EQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKK
ALPQKIQELEEPEERHTEL
Number of residues559
Molecular Weight61806.41
Theoretical pINot Available
GO Classification
Functions
  • methylumbelliferyl-acetate deacetylase activity
  • carboxylic ester hydrolase activity
Processes
  • small molecule metabolic process
  • xenobiotic metabolic process
  • catabolic process
Components
  • endoplasmic reticulum lumen
  • endoplasmic reticulum
  • extracellular space
General FunctionMethylumbelliferyl-acetate deacetylase activity
Specific FunctionInvolved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Shows high catalytic efficiency for hydrolysis of cocaine, 4-methylumbelliferyl acetate, heroin and 6-monoacetylmorphine.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDO00748
UniProtKB Entry NameEST2_HUMAN
Cellular LocationEndoplasmic reticulum lumen
Gene sequence
>lcl|BSEQ0013276|Cocaine esterase (CES2)
ATGACTGCTCAGTCCCGCTCTCCTACCACACCCACCTTTCCCGGCCCAAGCCAGCGCACC
CCGCTGACTCCCTGCCCAGTCCAAACTCCAAGGCTGGGCAAGGCACTGATCCACTGCTGG
ACAGACCCGGGGCAGCCTCTGGGTGAACAGCAGCGTGTCCGCCGGCAGCGAACCGAGACC
AGCGAGCCGACCATGCGGCTGCACAGACTTCGTGCGCGGCTGAGCGCGGTGGCCTGTGGG
CTTCTGCTGCTTCTTGTCCGGGGCCAGGGCCAGGACTCAGCCAGTCCCATCCGGACCACA
CACACGGGGCAGGTGCTGGGGAGTCTTGTCCATGTGAAGGGCGCCAATGCCGGGGTCCAA
ACCTTCCTGGGAATTCCATTTGCCAAGCCACCTCTAGGTCCGCTGCGATTTGCACCCCCT
GAGCCCCCTGAATCTTGGAGTGGTGTGAGGGATGGAACCACCCATCCGGCCATGTGTCTA
CAGGACCTCACCGCAGTGGAGTCAGAGTTTCTTAGCCAGTTCAACATGACCTTCCCTTCC
GACTCCATGTCTGAGGACTGCCTGTACCTCAGCATCTACACGCCGGCCCATAGCCATGAA
GGCTCTAACCTGCCGGTGATGGTGTGGATCCACGGTGGTGCGCTTGTTTTTGGCATGGCT
TCCTTGTATGATGGTTCCATGCTGGCTGCCTTGGAGAACGTGGTGGTGGTCATCATCCAG
TACCGCCTGGGTGTCCTGGGCTTCTTCAGCACTGGAGACAAGCACGCAACCGGCAACTGG
GGCTACCTGGACCAAGTGGCTGCACTACGCTGGGTCCAGCAGAATATCGCCCACTTTGGA
GGCAACCCTGACCGTGTCACCATTTTTGGCGAGTCTGCGGGTGGCACGAGTGTGTCTTCG
CTTGTTGTGTCCCCCATATCCCAAGGACTCTTCCACGGAGCCATCATGGAGAGTGGCGTG
GCCCTCCTGCCCGGCCTCATTGCCAGCTCAGCTGATGTCATCTCCACGGTGGTGGCCAAC
CTGTCTGCCTGTGACCAAGTTGACTCTGAGGCCCTGGTGGGCTGCCTGCGGGGCAAGAGT
AAAGAGGAGATTCTTGCAATTAACAAGCCTTTCAAGATGATCCCCGGAGTGGTGGATGGG
GTCTTCCTGCCCAGGCACCCCCAGGAGCTGCTGGCCTCTGCCGACTTTCAGCCTGTCCCT
AGCATTGTTGGTGTCAACAACAATGAATTCGGCTGGCTCATCCCCAAGGTCATGAGGATC
TATGATACCCAGAAGGAAATGGACAGAGAGGCCTCCCAGGCTGCTCTGCAGAAAATGTTA
ACGCTGCTGATGTTGCCTCCTACATTTGGTGACCTGCTGAGGGAGGAGTACATTGGGGAC
AATGGGGATCCCCAGACCCTCCAAGCGCAGTTCCAGGAGATGATGGCGGACTCCATGTTT
GTGATCCCTGCACTCCAAGTAGCACATTTTCAGTGTTCCCGGGCCCCTGTGTACTTCTAC
GAGTTCCAGCATCAGCCCAGCTGGCTCAAGAACATCAGGCCACCGCACATGAAGGCAGAC
CATGGTGATGAGCTTCCTTTTGTTTTCAGAAGTTTCTTTGGGGGCAACTACATTAAATTC
ACTGAGGAAGAGGAGCAGCTAAGCAGGAAGATGATGAAGTACTGGGCCAACTTTGCGAGA
AATGGGAACCCCAATGGCGAGGGTCTGCCACACTGGCCGCTGTTCGACCAGGAGGAGCAA
TACCTGCAGCTGAACCTACAGCCTGCGGTGGGCCGGGCTCTGAAGGCCCACAGGCTCCAG
TTCTGGAAGAAGGCGCTGCCCCAAAAGATCCAGGAGCTCGAGGAGCCTGAAGAGAGACAC
ACAGAGCTGTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:1864
Chromosome Location16
LocusNot Available
References
  1. Schwer H, Langmann T, Daig R, Becker A, Aslanidis C, Schmitz G: Molecular cloning and characterization of a novel putative carboxylesterase, present in human intestine and liver. Biochem Biophys Res Commun. 1997 Apr 7;233(1):117-20. 9144407
  2. Pindel EV, Kedishvili NY, Abraham TL, Brzezinski MR, Zhang J, Dean RA, Bosron WF: Purification and cloning of a broad substrate specificity human liver carboxylesterase that catalyzes the hydrolysis of cocaine and heroin. J Biol Chem. 1997 Jun 6;272(23):14769-75. 9169443
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  5. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. 15616553
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  7. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. 19159218
  8. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  9. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  10. Saito S, Iida A, Sekine A, Kawauchi S, Higuchi S, Ogawa C, Nakamura Y: Catalog of 680 variations among eight cytochrome p450 ( CYP) genes, nine esterase genes, and two other genes in the Japanese population. J Hum Genet. 2003;48(5):249-70. Epub 2003 Apr 29. 12721789
  11. Kim SR, Nakamura T, Saito Y, Sai K, Nakajima T, Saito H, Shirao K, Minami H, Ohtsu A, Yoshida T, Saijo N, Ozawa S, Sawada J: Twelve novel single nucleotide polymorphisms in the CES2 gene encoding human carboxylesterase 2 (hCE-2). Drug Metab Pharmacokinet. 2003;18(5):327-32. 15618752