You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameReceptor-type tyrosine-protein phosphatase T
Synonyms
  • 3.1.3.48
  • KIAA0283
  • R-PTP-T
  • Receptor-type tyrosine-protein phosphatase rho
  • RPTP-rho
Gene NamePTPRT
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009015|Receptor-type tyrosine-protein phosphatase T
MASLAALALSLLLRLQLPPLPGARAQSAAGGCSFDEHYSNCGYSVALGTNGFTWEQINTW
EKPMLDQAVPTGSFMMVNSSGRASGQKAHLLLPTLKENDTHCIDFHYYFSSRDRSSPGAL
NVYVKVNGGPQGNPVWNVSGVVTEGWVKAELAISTFWPHFYQVIFESVSLKGHPGYIAVD
EVRVLAHPCRKAPHFLRLQNVEVNVGQNATFQCIAGGKWSQHDKLWLQQWNGRDTALMVT
RVVNHRRFSATVSVADTAQRSVSKYRCVIRSDGGSGVSNYAELIVKEPPTPIAPPELLAV
GATYLWIKPNANSIIGDGPIILKEVEYRTTTGTWAETHIVDSPNYKLWHLDPDVEYEIRV
LLTRPGEGGTGPPGPPLTTRTKCADPVHGPQNVEIVDIRARQLTLQWEPFGYAVTRCHSY
NLTVQYQYVFNQQQYEAEEVIQTSSHYTLRGLRPFMTIRLRLLLSNPEGRMESEELVVQT
EEDVPGAVPLESIQGGPFEEKIYIQWKPPNETNGVITLYEINYKAVGSLDPSADLSSQRG
KVFKLRNETHHLFVGLYPGTTYSFTIKASTAKGFGPPVTTRIATKISAPSMPEYDTDTPL
NETDTTITVMLKPAQSRGAPVSVYQLVVKEERLQKSRRAADIIECFSVPVSYRNASSLDS
LHYFAAELKPANLPVTQPFTVGDNKTYNGYWNPPLSPLKSYSIYFQALSKANGETKINCV
RLATKGASTQNSNTVEPEKQVDNTVKMAGVIAGLLMFIIILLGVMLTIKRRRNAYSYSYY
LKLAKKQKETQSGAQREMGPVASADKPTTKLSASRNDEGFSSSSQDVNGFTDGSRGELSQ
PTLTIQTHPYRTCDPVEMSYPRDQFQPAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQ
TASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINANYIDGYHRPRHYIAT
QGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEP
LAEYVIRTFTVQKKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPI
VVHCSAGAGRTGCFIAIDTMLDMAENEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAI
LEACLCGNTAIPVCEFRSLYYNISRLDPQTNSSQIKDEFQTLNIVTPRVRPEDCSIGLLP
RNHDKNRSMDVLPLDRCLPFLISVDGESSNYINAALMDSHKQPAAFVVTQHPLPNTVADF
WRLVFDYNCSSVVMLNEMDTAQFCMQYWPEKTSGCYGPIQVEFVSADIDEDIIHRIFRIC
NMARPQDGYRIVQHLQYIGWPAYRDTPPSKRSLLKVVRRLEKWQEQYDGREGRTVVHCLN
GGGRSGTFCAICSVCEMIQQQNIIDVFHIVKTLRNNKSNMVETLEQYKFVYEVALEYLSS
F
Number of residues1441
Molecular Weight162132.92
Theoretical pINot Available
GO Classification
Functions
  • alpha-catenin binding
  • cadherin binding
  • beta-catenin binding
  • delta-catenin binding
  • gamma-catenin binding
  • protein tyrosine phosphatase activity
Processes
  • protein dephosphorylation
  • homophilic cell adhesion via plasma membrane adhesion molecules
  • peptidyl-tyrosine dephosphorylation
  • signal transduction
  • cell adhesion
  • transmembrane receptor protein tyrosine kinase signaling pathway
Components
  • plasma membrane
  • cell surface
  • integral component of membrane
General FunctionProtein tyrosine phosphatase activity
Specific FunctionMay be involved in both signal transduction and cellular adhesion in the CNS.
Pfam Domain Function
Transmembrane Regions748-768
GenBank Protein IDNot Available
UniProtKB IDO14522
UniProtKB Entry NamePTPRT_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0013564|Receptor-type tyrosine-protein phosphatase T (PTPRT)
ATGGCGAGCCTCGCCGCGCTCGCCCTCAGCCTGCTCCTGAGGCTGCAGCTGCCGCCACTG
CCCGGCGCCCGGGCTCAGAGCGCCGCAGGTGGCTGTTCCTTTGATGAGCACTACAGCAAC
TGTGGTTATAGTGTGGCTCTAGGGACCAATGGGTTCACCTGGGAGCAGATTAACACATGG
GAGAAACCAATGCTGGACCAGGCAGTGCCCACAGGATCTTTCATGATGGTGAACAGCTCT
GGGAGAGCCTCTGGCCAGAAGGCCCACCTTCTCCTGCCAACCCTGAAGGAGAATGACACC
CACTGCATCGACTTCCATTACTACTTCTCCAGCCGTGACAGGTCCAGCCCAGGGGCCTTG
AACGTCTACGTGAAGGTGAATGGTGGCCCCCAAGGGAACCCTGTGTGGAATGTGTCCGGG
GTCGTCACTGAGGGCTGGGTGAAGGCAGAGCTCGCCATCAGCACTTTCTGGCCACATTTC
TATCAGGTGATATTTGAATCCGTCTCATTGAAGGGTCATCCTGGCTACATCGCCGTGGAC
GAGGTCCGGGTCCTTGCTCATCCATGCAGAAAAGCACCTCATTTTCTGCGACTCCAAAAC
GTGGAGGTGAATGTGGGGCAGAATGCCACATTTCAGTGCATTGCTGGTGGGAAGTGGTCT
CAGCATGACAAGCTTTGGCTCCAGCAATGGAATGGCAGGGACACGGCCCTGATGGTCACC
CGTGTGGTCAACCACAGGCGCTTCTCAGCCACAGTCAGTGTGGCAGACACTGCCCAGCGG
AGCGTCAGCAAGTACCGCTGTGTGATCCGCTCTGATGGTGGGTCTGGTGTGTCCAACTAC
GCGGAGCTGATCGTGAAAGAGCCTCCCACGCCCATTGCTCCCCCAGAGCTGCTGGCTGTG
GGGGCCACATACCTGTGGATCAAGCCAAATGCCAACTCCATCATCGGGGATGGCCCCATC
ATCCTGAAGGAAGTGGAATATCGCACCACCACAGGCACGTGGGCAGAGACCCACATAGTC
GACTCTCCCAACTATAAGCTGTGGCATCTGGACCCCGATGTTGAGTATGAGATCCGAGTG
CTCCTCACACGACCAGGTGAGGGGGGTACGGGACCGCCAGGGCCTCCCCTCACCACCAGG
ACCAAGTGTGCAGATCCGGTACATGGCCCACAGAACGTGGAAATCGTAGACATCAGAGCC
CGGCAGCTGACCCTGCAGTGGGAGCCCTTCGGCTACGCGGTGACCCGCTGCCATAGCTAC
AACCTCACCGTGCAGTACCAGTATGTGTTCAACCAGCAGCAGTACGAGGCCGAGGAGGTC
ATCCAGACCTCCTCCCACTACACCCTGCGAGGCCTGCGCCCCTTCATGACCATCCGGCTG
CGACTCTTGCTGTCTAACCCCGAGGGCCGAATGGAGAGCGAGGAGCTGGTGGTGCAGACT
GAGGAAGACGTTCCAGGAGCTGTTCCTCTAGAATCCATCCAAGGGGGGCCCTTTGAGGAG
AAGATCTACATCCAGTGGAAACCTCCCAATGAGACCAATGGGGTCATCACGCTCTACGAG
ATCAACTACAAGGCTGTCGGCTCGCTGGACCCAAGTGCTGACCTCTCGAGCCAGAGGGGG
AAAGTGTTCAAGCTCCGGAATGAAACCCACCACCTCTTTGTGGGTCTGTACCCAGGGACC
ACCTATTCCTTCACCATCAAGGCCAGCACAGCAAAGGGCTTTGGGCCCCCTGTCACCACT
CGGATTGCCACCAAAATTTCAGCTCCATCCATGCCTGAGTACGACACAGACACCCCATTG
AATGAGACAGACACGACCATCACAGTGATGCTGAAACCCGCTCAGTCCCGGGGAGCTCCT
GTCAGTGTTTATCAGCTGGTTGTCAAGGAGGAGCGACTTCAGAAGTCACGGAGGGCAGCT
GACATTATTGAGTGCTTTTCGGTGCCCGTGAGCTATCGGAATGCCTCCAGCCTCGATTCT
CTACACTACTTTGCTGCTGAGTTGAAGCCTGCCAACCTGCCTGTCACCCAGCCATTTACA
GTGGGTGACAATAAGACATACAATGGCTACTGGAACCCTCCTCTCTCTCCCCTGAAAAGC
TACAGCATCTACTTCCAGGCACTCAGCAAAGCCAATGGAGAGACCAAAATCAACTGTGTT
CGTCTGGCTACAAAAGGTGCCTCCACCCAGAATTCTAACACTGTGGAGCCAGAGAAGCAG
GTGGACAACACCGTGAAGATGGCTGGCGTGATCGCTGGCCTCCTCATGTTCATCATCATT
CTCCTGGGCGTGATGCTCACCATCAAAAGGAGAAGAAATGCTTATTCCTACTCCTATTAC
TTGAAGCTGGCCAAGAAGCAGAAGGAGACCCAGAGTGGAGCCCAGAGGGAGATGGGGCCT
GTGGCCTCTGCCGACAAACCCACCACCAAGCTCAGCGCCAGCCGCAATGATGAAGGCTTC
TCTTCTAGTTCTCAGGACGTCAACGGATTCACAGATGGCAGCCGCGGGGAGCTTTCCCAG
CCCACCCTCACGATCCAGACTCATCCCTACCGCACCTGTGACCCTGTGGAGATGAGCTAC
CCCCGGGACCAGTTCCAACCCGCCATCCGGGTGGCTGACTTGCTGCAGCACATCACGCAG
ATGAAGAGAGGCCAGGGCTACGGGTTCAAGGAGGAATACGAGGCCTTACCAGAGGGGCAG
ACAGCTTCGTGGGACACAGCCAAGGAGGATGAAAACCGCAATAAGAATCGATATGGGAAC
ATCATATCCTACGACCATTCCCGGGTGAGGCTGCTGGTGCTGGATGGAGACCCGCACTCT
GACTACATCAATGCCAACTACATTGACGGATACCATCGACCTCGGCACTACATTGCGACT
CAAGGTCCGATGCAGGAGACTGTAAAGGACTTTTGGAGAATGATCTGGCAGGAGAACTCC
GCCAGCATCGTCATGGTCACAAACCTGGTGGAAGTGGGCAGGGTGAAATGTGTGCGATAC
TGGCCAGATGACACGGAGGTCTACGGAGACATTAAAGTCACCCTGATTGAAACAGAGCCC
CTGGCAGAATACGTCATACGCACCTTCACAGTCCAGAAGAAAGGCTACCATGAGATCCGG
GAGCTCCGCCTCTTCCACTTCACCAGCTGGCCTGACCACGGCGTTCCCTGCTATGCCACT
GGCCTTCTGGGCTTCGTCCGCCAGGTCAAGTTCCTCAACCCCCCGGAAGCTGGGCCCATA
GTGGTCCACTGCAGTGCTGGGGCTGGGCGGACTGGCTGCTTCATTGCCATTGACACCATG
CTTGACATGGCCGAGAATGAAGGGGTGGTGGACATCTTCAACTGCGTGCGTGAGCTCCGG
GCCCAAAGGGTCAACCTGGTACAGACAGAGGAGCAATATGTGTTTGTGCACGATGCCATC
CTGGAAGCGTGCCTCTGTGGCAACACTGCCATCCCTGTGTGTGAGTTCCGTTCTCTCTAC
TACAATATCAGCAGGCTGGACCCCCAGACAAACTCCAGCCAAATCAAAGATGAATTTCAG
ACCCTCAACATTGTGACACCCCGTGTGCGGCCCGAGGACTGCAGCATTGGGCTCCTGCCC
CGGAACCATGATAAGAATCGAAGTATGGACGTGCTGCCTCTGGACCGCTGCCTGCCCTTC
CTTATCTCAGTGGACGGAGAATCCAGCAATTACATCAACGCAGCACTGATGGATAGCCAC
AAGCAGCCTGCCGCCTTCGTGGTCACCCAGCACCCTCTACCCAACACCGTGGCAGACTTC
TGGAGGCTGGTGTTCGATTACAACTGCTCCTCTGTGGTGATGCTGAATGAGATGGACACT
GCCCAGTTCTGTATGCAGTACTGGCCTGAGAAGACCTCCGGGTGCTATGGGCCCATCCAG
GTGGAGTTCGTCTCCGCAGACATCGACGAGGACATCATCCACAGAATATTCCGCATCTGT
AACATGGCCCGGCCACAGGATGGTTATCGTATAGTCCAGCACCTCCAGTACATTGGCTGG
CCTGCCTACCGGGACACGCCCCCCTCCAAGCGCTCTCTGCTCAAAGTGGTCCGACGACTG
GAGAAGTGGCAGGAGCAGTATGACGGGAGGGAGGGACGTACTGTGGTCCACTGCCTAAAT
GGGGGAGGCCGTAGTGGAACCTTCTGTGCCATCTGCAGTGTGTGTGAGATGATCCAGCAG
CAAAACATCATTGACGTGTTCCACATCGTGAAAACACTGCGTAACAACAAATCCAACATG
GTGGAGACCCTGGAACAGTATAAATTTGTATACGAGGTGGCACTGGAATATTTAAGCTCC
TTTTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9682
Chromosome Location20
LocusNot Available
References
  1. McAndrew PE, Frostholm A, White RA, Rotter A, Burghes AH: Identification and characterization of RPTP rho, a novel RPTP mu/kappa-like receptor protein tyrosine phosphatase whose expression is restricted to the central nervous system. Brain Res Mol Brain Res. 1998 May;56(1-2):9-21. 9602027
  2. Ohara O, Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Nomura N: Construction and characterization of human brain cDNA libraries suitable for analysis of cDNA clones encoding relatively large proteins. DNA Res. 1997 Feb 28;4(1):53-9. 9179496
  3. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. 11780052
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Besco JA, Frostholm A, Popesco MC, Burghes AH, Rotter A: Genomic organization and alternative splicing of the human and mouse RPTPrho genes. BMC Genomics. 2001;2:1. Epub 2001 Jun 8. 11423001
  6. Besco JA, Frostholm A, Popesco MC, Burghes AH, Rotter A: Genomic organization and alternative splicing of the human and mouse RPTPrho genes: Correction. BMC Genomics. 2001;2:5. Epub 2001 Aug 14. 11814386
  7. Barr AJ, Ugochukwu E, Lee WH, King ON, Filippakopoulos P, Alfano I, Savitsky P, Burgess-Brown NA, Muller S, Knapp S: Large-scale structural analysis of the classical human protein tyrosine phosphatome. Cell. 2009 Jan 23;136(2):352-63. doi: 10.1016/j.cell.2008.11.038. 19167335
  8. Wang Z, Shen D, Parsons DW, Bardelli A, Sager J, Szabo S, Ptak J, Silliman N, Peters BA, van der Heijden MS, Parmigiani G, Yan H, Wang TL, Riggins G, Powell SM, Willson JK, Markowitz S, Kinzler KW, Vogelstein B, Velculescu VE: Mutational analysis of the tyrosine phosphatome in colorectal cancers. Science. 2004 May 21;304(5674):1164-6. 15155950
  9. Ley TJ, Mardis ER, Ding L, Fulton B, McLellan MD, Chen K, Dooling D, Dunford-Shore BH, McGrath S, Hickenbotham M, Cook L, Abbott R, Larson DE, Koboldt DC, Pohl C, Smith S, Hawkins A, Abbott S, Locke D, Hillier LW, Miner T, Fulton L, Magrini V, Wylie T, Glasscock J, Conyers J, Sander N, Shi X, Osborne JR, Minx P, Gordon D, Chinwalla A, Zhao Y, Ries RE, Payton JE, Westervelt P, Tomasson MH, Watson M, Baty J, Ivanovich J, Heath S, Shannon WD, Nagarajan R, Walter MJ, Link DC, Graubert TA, DiPersio JF, Wilson RK: DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome. Nature. 2008 Nov 6;456(7218):66-72. doi: 10.1038/nature07485. 18987736
  10. Schuurs-Hoeijmakers JH, Vulto-van Silfhout AT, Vissers LE, van de Vondervoort II, van Bon BW, de Ligt J, Gilissen C, Hehir-Kwa JY, Neveling K, del Rosario M, Hira G, Reitano S, Vitello A, Failla P, Greco D, Fichera M, Galesi O, Kleefstra T, Greally MT, Ockeloen CW, Willemsen MH, Bongers EM, Janssen IM, Pfundt R, Veltman JA, Romano C, Willemsen MA, van Bokhoven H, Brunner HG, de Vries BB, de Brouwer AP: Identification of pathogenic gene variants in small families with intellectually disabled siblings by exome sequencing. J Med Genet. 2013 Dec;50(12):802-11. doi: 10.1136/jmedgenet-2013-101644. Epub 2013 Oct 11. 24123876