You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameChromodomain-helicase-DNA-binding protein 1
Synonyms
  • 3.6.4.12
  • ATP-dependent helicase CHD1
  • CHD-1
Gene NameCHD1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037040|Chromodomain-helicase-DNA-binding protein 1
MNGHSDEESVRNSSGESSQSDDDSGSASGSGSGSSSGSSSDGSSSQSGSSDSDSGSESGS
QSESESDTSRENKVQAKPPKVDGAEFWKSSPSILAVQRSAILKKQQQQQQQQQHQASSNS
GSEEDSSSSEDSDDSSSEVKRKKHKDEDWQMSGSGSPSQSGSDSESEEEREKSSCDETES
DYEPKNKVKSRKPQNRSKSKNGKKILGQKKRQIDSSEEDDDEEDYDNDKRSSRRQATVNV
SYKEDEEMKTDSDDLLEVCGEDVPQPEEEEFETIERFMDCRIGRKGATGATTTIYAVEAD
GDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETK
RWLKNASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSE
CSWEDGALISKKFQACIDEYFSRNQSKTTPFKDCKVLKQRPRFVALKKQPSYIGGHEGLE
LRDYQLNGLNWLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLS
TLTSWQREIQTWASQMNAVVYLGDINSRNMIRTHEWTHHQTKRLKFNILLTTYEILLKDK
AFLGGLNWAFIGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFI
MPEKFSSWEDFEEEHGKGREYGYASLHKELEPFLLRRVKKDVEKSLPAKVEQILRMEMSA
LQKQYYKWILTRNYKALSKGSKGSTSGFLNIMMELKKCCNHCYLIKPPDNNEFYNKQEAL
QHLIRSSGKLILLDKLLIRLRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKG
ELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHR
IGQKKQVNIYRLVTKGSVEEDILERAKKKMVLDHLVIQRMDTTGKTVLHTGSAPSSSTPF
NKEELSAILKFGAEELFKEPEGEEQEPQEMDIDEILKRAETHENEPGPLTVGDELLSQFK
VANFSNMDEDDIELEPERNSKNWEEIIPEDQRRRLEEEERQKELEEIYMLPRMRNCAKQI
SFNGSEGRRSRSRRYSGSDSDSISEGKRPKKRGRPRTIPRENIKGFSDAEIRRFIKSYKK
FGGPLERLDAIARDAELVDKSETDLRRLGELVHNGCIKALKDSSSGTERTGGRLGKVKGP
TFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSN
LLIGIYEYGYGSWEMIKMDPDLSLTHKILPDDPDKKPQAKQLQTRADYLIKLLSRDLAKK
EALSGAGSSKRRKARAKKNKAMKSIKVKEEIKSDSSPLPSEKSDEDDDKLSESKSDGRER
SKKSSVSDAPVHITASGEPVPISEESEELDQKTFSICKERMRPVKAALKQLDRPEKGLSE
REQLEHTRQCLIKIGDHITECLKEYTNPEQIKQWRKNLWIFVSKFTEFDARKLHKLYKHA
IKKRQESQQNSDQNSNLNPHVIRNPDVERLKENTNHDDSSRDSYSSDRHLTQYHDHHKDR
HQGDSYKKSDSRKRPYSSFSNGKDHRDWDHYKQDSRYYSDREKHRKLDDHRSRDHRSNLE
GSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRYHSDWQMDHRASSSGPRSPLD
QRSPYGSRSPFEHSVEHKSTPEHTWSSRKT
Number of residues1710
Molecular Weight196685.865
Theoretical pI7.17
GO Classification
Functions
  • DNA binding
  • ATP-dependent DNA helicase activity
  • methylated histone binding
  • ATP binding
Processes
  • transcription, DNA-templated
  • regulation of transcription from RNA polymerase II promoter
  • DNA duplex unwinding
  • chromatin remodeling
  • positive regulation by host of viral transcription
Components
  • nucleus
  • cytoplasm
General FunctionMethylated histone binding
Specific FunctionATP-dependent chromatin-remodeling factor which functions as substrate recognition component of the transcription regulatory histone acetylation (HAT) complex SAGA. Regulates polymerase II transcription. Also required for efficient transcription by RNA polymerase I, and more specifically the polymerase I transcription termination step. Regulates negatively DNA replication. Not only involved in transcription-related chromatin-remodeling, but also required to maintain a specific chromatin configuration across the genome. Is also associated with histone deacetylase (HDAC) activity (By similarity). Required for the bridging of SNF2, the FACT complex, the PAF complex as well as the U2 snRNP complex to H3K4me3. Functions to modulate the efficiency of pre-mRNA splicing in part through physical bridging of spliceosomal components to H3K4me3. Required for maintaining open chromatin and pluripotency in embryonic stem cells.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID2645429
UniProtKB IDO14646
UniProtKB Entry NameCHD1_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0018968|Chromodomain-helicase-DNA-binding protein 1 (CHD1)
ATGAATGGACACAGTGATGAAGAAAGTGTTAGAAACAGTAGTGGAGAATCAAGCCAGTCG
GATGATGATTCTGGGTCAGCTTCAGGCTCTGGATCTGGTTCGAGTTCTGGAAGCAGTAGT
GATGGAAGCAGTAGCCAGTCAGGTAGCAGTGACTCTGACTCCGGATCTGAATCAGGCAGT
CAGTCAGAGTCTGAGTCAGACACTTCCCGAGAAAACAAAGTTCAAGCAAAACCACCGAAA
GTTGATGGAGCTGAGTTTTGGAAATCTAGTCCTAGTATTCTGGCCGTTCAGAGATCTGCA
ATCCTCAAGAAGCAGCAACAGCAGCAGCAGCAACAACAACATCAAGCCTCATCTAATAGC
GGATCAGAAGAGGATTCCTCTAGCAGTGAAGATTCCGATGACTCATCAAGTGAGGTCAAA
AGGAAAAAGCATAAAGATGAAGATTGGCAAATGTCTGGGTCAGGATCTCCATCTCAGTCT
GGTTCAGATTCAGAATCTGAAGAAGAGAGAGAGAAAAGCAGTTGTGATGAAACAGAATCT
GATTATGAGCCAAAAAACAAAGTCAAAAGCAGAAAACCTCAAAATAGATCTAAGTCAAAA
AATGGAAAGAAGATTCTTGGACAAAAAAAGAGACAGATTGATTCATCTGAGGAGGATGAT
GATGAAGAAGATTATGATAATGATAAAAGAAGTTCTCGTCGCCAAGCAACTGTTAATGTT
AGCTATAAGGAGGATGAAGAAATGAAAACAGATTCTGATGACCTACTGGAAGTCTGTGGA
GAGGATGTTCCTCAACCTGAGGAAGAGGAATTTGAAACCATAGAAAGATTTATGGATTGT
CGGATTGGGAGAAAAGGAGCTACTGGTGCTACTACAACCATCTATGCAGTTGAAGCAGAT
GGTGACCCAAATGCAGGCTTTGAAAAAAACAAAGAACCAGGAGAGATTCAGTATTTAATT
AAATGGAAAGGATGGTCCCATATCCACAACACTTGGGAGACAGAAGAAACCCTCAAGCAG
CAGAATGTTAGAGGAATGAAAAAATTGGATAATTATAAGAAAAAAGATCAGGAAACAAAA
AGATGGTTGAAAAATGCCTCTCCAGAAGATGTGGAATATTATAATTGCCAGCAAGAACTT
ACAGATGATCTACATAAACAGTATCAAATAGTGGAACGTATAATTGCTCATTCCAATCAA
AAGTCAGCAGCTGGTTATCCTGATTATTACTGCAAATGGCAGGGCCTTCCATACTCAGAG
TGCAGCTGGGAAGATGGAGCTCTCATTTCCAAAAAGTTTCAAGCATGCATTGATGAGTAT
TTTAGCAGGAACCAATCAAAAACCACTCCTTTTAAAGATTGCAAAGTATTAAAACAAAGG
CCAAGGTTTGTAGCCCTGAAGAAGCAGCCATCCTATATTGGAGGACATGAGGGCTTAGAA
TTAAGAGATTATCAACTGAATGGTTTAAATTGGCTTGCTCATTCTTGGTGCAAAGGAAAT
AGTTGCATACTCGCTGATGAAATGGGCCTTGGAAAAACAATACAGACGATCTCATTTCTG
AATTATTTGTTTCATGAACATCAATTATATGGACCTTTTTTATTGGTAGTACCGCTCTCC
ACTCTTACTTCCTGGCAAAGGGAAATTCAGACTTGGGCTTCTCAAATGAATGCTGTGGTT
TATTTAGGTGACATTAACAGCAGAAACATGATAAGAACTCATGAATGGACGCATCATCAG
ACCAAACGGTTAAAATTTAATATATTGTTAACAACTTATGAAATTTTATTAAAAGATAAG
GCATTCCTTGGAGGTCTAAATTGGGCATTTATAGGTGTTGATGAAGCACACCGATTAAAG
AATGATGACTCCCTTCTGTATAAAACTTTAATAGATTTTAAATCCAATCATCGTCTCCTT
ATCACTGGAACTCCTCTACAGAATTCCCTCAAAGAGCTCTGGTCTTTGCTACATTTCATT
ATGCCAGAAAAGTTTTCTTCCTGGGAAGATTTTGAAGAAGAACATGGCAAAGGGAGAGAA
TATGGTTATGCAAGCCTTCACAAGGAGCTTGAGCCATTTCTGTTACGCCGAGTTAAGAAA
GATGTGGAAAAATCTCTTCCTGCCAAGGTTGAGCAGATTTTAAGAATGGAAATGAGTGCT
TTACAGAAACAATATTACAAATGGATTTTAACTAGGAATTACAAAGCCCTCAGCAAAGGT
TCCAAGGGCAGTACCTCAGGCTTTTTGAACATTATGATGGAGCTAAAGAAATGTTGTAAC
CATTGCTACCTCATTAAACCACCAGATAATAATGAATTCTATAATAAACAGGAGGCCTTA
CAACACTTAATTCGTAGTAGCGGAAAATTGATTCTTCTTGACAAGCTATTAATTCGCCTA
AGAGAACGAGGCAATCGAGTTCTTATTTTTTCACAAATGGTGCGGATGTTAGATATACTT
GCAGAATATTTGAAATATCGTCAATTCCCCTTTCAAAGATTAGATGGATCAATAAAAGGA
GAACTGAGGAAACAAGCTCTAGATCATTTTAATGCTGAGGGATCAGAGGATTTTTGCTTT
TTGCTGTCCACAAGAGCTGGAGGTCTAGGGATTAATTTAGCCTCTGCTGACACTGTTGTT
ATATTTGATTCCGATTGGAATCCACAGAATGATCTTCAGGCACAGGCTAGAGCCCATCGA
ATTGGGCAAAAGAAACAGGTGAATATTTATCGTCTAGTTACAAAGGGATCAGTTGAAGAA
GATATTCTTGAAAGGGCGAAAAAGAAGATGGTTTTAGATCATCTTGTAATTCAAAGAATG
GACACAACTGGGAAGACAGTACTACATACAGGTTCTGCCCCATCAAGTTCTACTCCTTTC
AATAAAGAAGAGTTATCAGCCATTTTAAAGTTTGGTGCTGAAGAACTTTTTAAGGAACCT
GAAGGAGAAGAACAAGAGCCCCAGGAAATGGATATAGATGAAATCTTGAAGAGAGCTGAA
ACTCATGAAAATGAACCAGGTCCTTTAACTGTAGGAGATGAATTGCTTTCCCAGTTCAAG
GTTGCCAACTTCTCAAATATGGATGAGGATGACATTGAGTTGGAACCTGAAAGAAATTCA
AAGAATTGGGAGGAAATTATTCCAGAAGATCAAAGAAGACGATTAGAAGAAGAAGAAAGA
CAAAAGGAACTTGAAGAAATTTATATGCTCCCAAGAATGAGAAATTGTGCAAAACAGATT
AGTTTCAATGGAAGTGAAGGGAGGCGCAGTAGAAGTAGGAGATACTCTGGATCTGATAGT
GATTCCATCTCAGAAGGGAAAAGGCCAAAGAAACGTGGAAGACCACGGACTATTCCTCGG
GAGAATATTAAAGGATTTAGTGATGCAGAAATTAGGCGGTTTATCAAGAGCTATAAGAAA
TTTGGTGGTCCTCTGGAAAGATTAGATGCAATTGCTCGAGATGCTGAGTTAGTTGATAAG
TCAGAAACAGACCTTAGACGACTGGGAGAATTGGTACATAATGGTTGCATTAAAGCATTA
AAGGATAGTTCTTCAGGAACAGAACGAACAGGTGGTAGACTCGGAAAAGTGAAGGGTCCA
ACATTCCGAATATCAGGAGTACAGGTGAATGCCAAACTAGTCATCTCCCATGAAGAAGAA
TTAATACCTTTGCACAAATCCATTCCTTCTGATCCAGAAGAAAGAAAGCAGTATACTATC
CCATGCCACACAAAGGCAGCTCATTTTGATATAGACTGGGGCAAAGAAGATGATTCCAAT
TTGTTAATTGGCATCTATGAATATGGATATGGAAGCTGGGAAATGATTAAAATGGATCCT
GACCTCAGTCTAACACACAAGATTCTTCCAGATGATCCCGATAAAAAACCACAAGCAAAA
CAGTTGCAGACCCGTGCAGACTACCTCATCAAATTACTTAGTAGAGATCTTGCAAAAAAA
GAAGCTCTTTCTGGTGCGGGAAGTTCAAAGAGGAGAAAAGCAAGAGCTAAGAAGAATAAA
GCAATGAAGTCTATAAAAGTGAAAGAGGAAATAAAGAGTGATTCTTCTCCTCTGCCTTCA
GAGAAGTCTGATGAAGATGATGATAAATTGAGTGAATCCAAGTCTGATGGTAGGGAAAGA
TCCAAGAAATCTTCAGTGTCAGATGCTCCAGTTCATATCACGGCAAGTGGTGAACCAGTT
CCCATTTCTGAAGAATCTGAAGAGCTGGATCAGAAGACATTCAGCATTTGTAAAGAAAGA
ATGAGGCCTGTTAAAGCAGCTTTGAAACAACTTGATAGGCCTGAGAAAGGCCTTTCAGAA
AGAGAACAACTAGAGCATACTAGACAATGTTTAATAAAAATTGGAGACCATATCACAGAA
TGTCTAAAAGAGTATACAAATCCTGAACAAATTAAGCAATGGAGAAAAAACCTGTGGATT
TTTGTATCTAAGTTTACTGAATTTGATGCAAGAAAATTACATAAATTATATAAGCATGCT
ATTAAAAAACGGCAGGAGTCTCAGCAAAACAGTGATCAAAACAGCAACTTGAATCCTCAC
GTGATTAGAAATCCAGATGTGGAAAGATTAAAAGAGAATACAAATCACGATGATAGCAGC
AGGGACAGTTATTCCTCTGATAGACACTTAACTCAGTACCATGATCATCATAAAGACCGA
CATCAGGGAGATTCTTACAAAAAAAGTGATTCCAGGAAAAGACCCTATTCTTCTTTTAGT
AATGGTAAAGACCATCGTGATTGGGATCACTACAAGCAAGACAGCAGATATTACAGTGAC
AGAGAGAAACACAGAAAACTGGATGATCACAGGAGTAGAGATCACAGGTCAAATTTGGAA
GGAAGTTTAAAAGATAGATCTCATTCTGATCATCGTTCTCACTCAGATCATCGGTTACAT
TCAGACCACCGGTCAAGTTCTGAATATACGCACCATAAATCTTCCAGGGATTATAGGTAT
CACTCAGACTGGCAAATGGACCACAGAGCTTCCAGCAGTGGCCCTAGGTCACCACTAGAT
CAGAGATCTCCTTATGGCTCCAGATCTCCATTTGAACATTCAGTTGAACACAAAAGTACA
CCGGAGCATACCTGGAGTAGTCGGAAAACATAA
GenBank Gene IDAF006513
GeneCard IDNot Available
GenAtlas IDCHD1
HGNC IDHGNC:1915
Chromosome Location5
Locus5q15-q21
References
  1. Woodage T, Basrai MA, Baxevanis AD, Hieter P, Collins FS: Characterization of the CHD family of proteins. Proc Natl Acad Sci U S A. 1997 Oct 14;94(21):11472-7. 9326634
  2. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. 15372022
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Sims RJ 3rd, Chen CF, Santos-Rosa H, Kouzarides T, Patel SS, Reinberg D: Human but not yeast CHD1 binds directly and selectively to histone H3 methylated at lysine 4 via its tandem chromodomains. J Biol Chem. 2005 Dec 23;280(51):41789-92. Epub 2005 Oct 31. 16263726
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. 17081983
  6. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. 16964243
  7. Flanagan JF, Blus BJ, Kim D, Clines KL, Rastinejad F, Khorasanizadeh S: Molecular implications of evolutionary differences in CHD double chromodomains. J Mol Biol. 2007 Jun 1;369(2):334-42. Epub 2007 Mar 19. 17433364
  8. Sims RJ 3rd, Millhouse S, Chen CF, Lewis BA, Erdjument-Bromage H, Tempst P, Manley JL, Reinberg D: Recognition of trimethylated histone H3 lysine 4 facilitates the recruitment of transcription postinitiation factors and pre-mRNA splicing. Mol Cell. 2007 Nov 30;28(4):665-76. 18042460
  9. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. 18691976
  10. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  11. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  12. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  13. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  14. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  15. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  16. Flanagan JF, Mi LZ, Chruszcz M, Cymborowski M, Clines KL, Kim Y, Minor W, Rastinejad F, Khorasanizadeh S: Double chromodomains cooperate to recognize the methylated histone H3 tail. Nature. 2005 Dec 22;438(7071):1181-5. 16372014