You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
Name5-oxoprolinase
Synonyms
  • 3.5.2.9
  • 5-OPase
  • 5-oxo-L-prolinase
  • Pyroglutamase
Gene NameOPLAH
OrganismHuman
Amino acid sequence
>lcl|BSEQ0004452|5-oxoprolinase
MGSPEGRFHFAIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRRILEQEAG
MLLPRDQPLDSSHIASIRMGTTVATNALLERKGERVALLVTRGFRDLLHIGTQARGDLFD
LAVPMPEVLYEEVLEVDERVVLHRGEAGTGTPVKGRTGDLLEVQQPVDLGALRGKLEGLL
SRGIRSLAVVLMHSYTWAQHEQQVGVLARELGFTHVSLSSEAMPMVRIVPRGHTACADAY
LTPAIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMDTFSGSSAVLSGPAGGVVGYSAT
TYQQEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRL
FFRSGLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGENQPLSP
EASRKALEAVATEVNSFLTNGPCPASPLSLEEVAMGFVRVANEAMCRPIRALTQARGHDP
SAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLLYA
PETFVQLDQRLSRLEEQCVDALQAQGFPRSQISTESFLHLRYQGTDCALMVSAHQHPATA
RSPRAGDFGAAFVERYMREFGFVIPERPVVVDDVRVRGTGRSGLRLEDAPKAQTGPPRVD
KMTQCYFEGGYQETPVYLLAELGYGHKLHGPCLIIDSNSTILVEPGCQAEVTKTGDICIS
VGAEVPGTVGPQLDPIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDG
GLVSNAPHIPVHLGAMQETVQFQIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFW
PGQTRPVFYVASRGHHADIGGITPGSMPPHSTMLQQEGAVFLSFKLVQGGVFQEEAVTEA
LRAPGKVPNCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANA
ELAVRDMLRAFGTSRQARGLPLEVSSEDHMDDGSPIRLRVQISLSQGSAVFDFSGTGPEV
FGNLNAPRAVTLSALIYCLRCLVGRDIPLNQGCLAPVRVVIPRGSILDPSPEAAVVGGNV
LTSQRVVDVILGAFGACAASQGCMNNVTLGNAHMGYYETVAGGAGAGPSWHGRSGVHSHM
TNTRITDPEILESRYPVILRRFELRRGSGGRGRFRGGDGVTRELLFREEALLSVLTERRA
FRPYGLHGGEPGARGLNLLIRKNGRTVNLGGKTSVTVYPGDVFCLHTPGGGGYGDPEDPA
PPPGSPPQALAFPEHGSVYEYRRAQEAV
Number of residues1288
Molecular Weight137456.195
Theoretical pI6.56
GO Classification
Functions
  • ATP binding
  • 5-oxoprolinase (ATP-hydrolyzing) activity
Processes
  • small molecule metabolic process
  • xenobiotic metabolic process
  • glutathione biosynthetic process
  • glutathione derivative biosynthetic process
Components
  • cytosol
General FunctionAtp binding
Specific FunctionCatalyzes the cleavage of 5-oxo-L-proline to form L-glutamate coupled to the hydrolysis of ATP to ADP and inorganic phosphate.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID46020040
UniProtKB IDO14841
UniProtKB Entry NameOPLA_HUMAN
Cellular LocationCytoplasmic
Gene sequence
>lcl|BSEQ0019258|5-oxoprolinase (OPLAH)
ATGGGCAGCCCCGAGGGCCGCTTCCACTTTGCCATCGACCGTGGGGGTACCTTCACAGAC
GTCTTTGCCCAGTGCCCAGGGGGGCACGTGCGGGTCTTAAAACTGCTCTCAGAGGACCCT
GCCAACTATGCGGACGCGCCAACCGAAGGCATCCGCCGCATCCTGGAGCAGGAGGCCGGC
ATGCTCCTGCCCCGGGACCAGCCGCTGGACTCCAGTCATATCGCCAGCATCCGCATGGGC
ACCACAGTGGCCACCAACGCACTGCTGGAGCGGAAGGGGGAGCGGGTGGCGCTGCTGGTG
ACACGTGGCTTCCGAGACCTGCTGCACATTGGCACCCAAGCCCGTGGGGACCTCTTTGAC
CTGGCCGTGCCCATGCCTGAGGTGCTGTATGAAGAGGTGCTGGAGGTGGACGAACGCGTG
GTGCTGCACCGTGGAGAGGCGGGCACCGGGACGCCTGTGAAAGGCCGCACGGGGGACCTG
CTGGAAGTGCAGCAGCCTGTGGACCTGGGGGCCCTGCGTGGGAAGCTGGAGGGGCTGCTA
TCTCGAGGCATCCGCAGCCTGGCTGTGGTGCTCATGCACTCGTACACGTGGGCCCAGCAT
GAGCAGCAGGTGGGTGTGCTGGCCCGGGAGCTGGGCTTCACGCACGTGTCACTGTCCTCG
GAGGCCATGCCCATGGTGCGCATCGTCCCTCGGGGGCACACGGCCTGTGCCGACGCCTAC
CTCACGCCCGCCATCCAGCGCTACGTGCAGGGCTTCTGCCGTGGCTTCCAGGGCCAACTC
AAGGATGTGCAGGTGTTGTTCATGCGCTCCGATGGCGGCCTGGCGCCCATGGACACCTTC
AGCGGCTCCAGTGCTGTGCTCTCGGGCCCGGCCGGCGGCGTGGTGGGCTACTCAGCCACC
ACCTACCAGCAGGAGGGTGGCCAGCCTGTCATCGGCTTTGACATGGGAGGCACGTCCACG
GATGTGAGCCGCTATGCTGGGGAATTCGAGCACGTCTTCGAGGCCAGCACAGCTGGCGTC
ACCCTCCAGGCCCCGCAGCTGGACATCAACACCGTGGCAGCGGGAGGGGGTTCCCGCCTC
TTCTTCAGGTCTGGCCTCTTTGTGGTTGGGCCCGAGTCAGCAGGAGCCCACCCAGGACCC
GCCTGCTACCGCAAAGGGGGCCCTGTGACAGTGACGGATGCTAATCTGGTCCTGGGTCGC
CTGCTGCCTGCCTCCTTCCCCTGCATTTTTGGGCCGGGAGAGAACCAACCACTTTCCCCT
GAGGCCTCCCGCAAAGCCCTGGAGGCTGTGGCCACTGAGGTCAACAGCTTCCTGACCAAC
GGGCCCTGCCCGGCCTCCCCGCTGAGCCTGGAGGAGGTGGCCATGGGGTTCGTGCGCGTG
GCCAACGAGGCCATGTGCCGGCCCATCCGTGCACTCACGCAGGCAAGAGGCCATGACCCC
TCAGCCCATGTGCTGGCCTGCTTTGGGGGAGCTGGTGGGCAGCATGCATGTGCCATCGCC
CGGGCCCTGGGCATGGACACGGTGCACATCCACAGGCACAGTGGGCTGCTGTCGGCCCTG
GGGCTGGCCCTGGCTGACGTGGTGCATGAGGCACAGGAACCCTGCTCCCTGCTCTACGCG
CCTGAGACCTTCGTGCAGCTGGACCAGAGGCTGAGCCGCCTGGAGGAGCAGTGTGTGGAT
GCTCTGCAGGCCCAGGGCTTCCCCAGGTCCCAGATCAGCACTGAGAGCTTCCTGCACCTG
CGCTACCAGGGCACGGACTGTGCTCTGATGGTGTCTGCCCACCAGCACCCAGCCACAGCC
CGCTCGCCCCGTGCGGGGGACTTCGGGGCAGCCTTTGTGGAGCGGTACATGAGGGAGTTT
GGCTTTGTCATACCTGAGCGGCCGGTGGTCGTGGACGATGTGCGAGTGCGGGGCACCGGC
CGCAGTGGTCTTCGCCTCGAGGATGCCCCCAAAGCCCAGACCGGGCCTCCCCGGGTGGAC
AAGATGACCCAGTGCTACTTTGAGGGGGGCTACCAGGAGACCCCTGTGTACCTGCTGGCA
GAGCTGGGCTATGGGCACAAGCTCCATGGGCCCTGCCTCATCATCGACAGTAACAGCACC
ATCCTGGTGGAGCCAGGTTGCCAGGCAGAGGTGACCAAGACAGGGGACATCTGCATCTCC
GTGGGGGCCGAAGTCCCCGGCACAGTGGGCCCCCAGCTGGACCCTATCCAGCTGTCCATC
TTCTCACACCGCTTCATGAGCATTGCTGAGCAGATGGGCCGCATCCTGCAGCGCACAGCC
ATCTCCACCAACATCAAGGAGCGTCTGGACTTCTCCTGTGCCCTCTTTGGGCCCGATGGG
GGGCTGGTGTCCAATGCCCCCCACATCCCTGTGCACCTGGGTGCCATGCAGGAGACGGTG
CAGTTCCAGATTCAGCACCTGGGGGCCGATCTCCACCCTGGCGACGTGCTACTGAGCAAC
CATCCCAGTGCCGGGGGCAGCCACCTGCCAGACCTGACTGTTATCACACCGGTGTTTTGG
CCGGGTCAGACGCGGCCTGTGTTCTATGTGGCCAGCCGAGGGCACCACGCAGACATCGGG
GGCATCACACCAGGCTCCATGCCCCCCCACTCCACCATGCTGCAACAGGAGGGTGCCGTC
TTTCTGTCCTTCAAACTTGTCCAGGGGGGCGTCTTCCAGGAGGAGGCGGTGACGGAGGCC
CTGCGGGCGCCAGGCAAGGTCCCCAACTGCAGCGGAACCAGAAACCTGCACGACAACCTG
TCGGACCTCCGTGCCCAGGTGGCAGCCAACCAGAAGGGCATCCAGCTGGTGGGGGAGCTC
ATTGGGCAGTACGGCCTGGACGTGGTGCAGGCCTACATGGGCCATATTCAGGCAAACGCT
GAGCTGGCCGTGCGAGACATGTTGCGTGCCTTTGGAACCTCCCGGCAGGCCCGGGGCCTG
CCCCTGGAGGTGTCCTCGGAAGACCACATGGACGACGGTTCCCCCATCCGCCTCCGTGTG
CAGATCAGCCTGAGTCAGGGCAGCGCCGTGTTTGACTTCAGCGGCACTGGGCCGGAGGTG
TTTGGTAATCTCAACGCACCGCGGGCCGTAACCCTGTCCGCCCTCATCTACTGCCTGCGC
TGTCTGGTGGGCCGCGACATCCCACTCAACCAGGGCTGCCTGGCGCCAGTGCGCGTGGTC
ATTCCCCGAGGCTCCATCCTGGACCCGTCGCCCGAGGCGGCGGTGGTGGGCGGCAACGTG
CTCACGTCGCAGCGCGTGGTGGATGTCATCCTGGGGGCCTTTGGGGCCTGCGCCGCCTCC
CAGGGCTGCATGAACAACGTGACCCTGGGCAACGCCCACATGGGCTACTACGAGACGGTG
GCGGGCGGCGCGGGCGCGGGTCCCAGCTGGCACGGGCGCAGCGGTGTGCACAGCCACATG
ACCAACACACGCATCACCGACCCTGAGATCCTGGAGAGCCGGTACCCGGTCATCCTGCGC
CGCTTCGAGCTGCGGCGGGGCTCGGGGGGCAGAGGCCGCTTCCGAGGCGGCGACGGCGTC
ACCCGCGAGCTGCTCTTTCGTGAGGAGGCGCTGCTGTCAGTGCTGACCGAGCGCCGCGCC
TTCCGGCCATACGGGCTCCACGGGGGCGAGCCTGGCGCCCGCGGCCTAAACCTGCTGATC
CGCAAAAACGGCCGGACGGTGAATCTGGGCGGCAAGACGTCGGTGACCGTGTACCCCGGG
GATGTGTTCTGTCTCCACACGCCCGGCGGCGGTGGCTATGGGGACCCGGAGGACCCCGCC
CCACCGCCGGGGTCGCCCCCGCAAGCACTGGCCTTTCCCGAGCACGGCAGCGTCTATGAG
TATCGCCGGGCCCAGGAGGCCGTGTGA
GenBank Gene IDAB122018
GeneCard IDNot Available
GenAtlas IDOPLAH
HGNC IDHGNC:8149
Chromosome Location8
Locus8q24.3
References
  1. Watanabe T, Abe K, Ishikawa H, Iijima Y: Bovine 5-oxo-L-prolinase: simple assay method, purification, cDNA cloning, and detection of mRNA in the coronary artery. Biol Pharm Bull. 2004 Mar;27(3):288-94. 14993790
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  4. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  5. Almaghlouth IA, Mohamed JY, Al-Amoudi M, Al-Ahaidib L, Al-Odaib A, Alkuraya FS: 5-Oxoprolinase deficiency: report of the first human OPLAH mutation. Clin Genet. 2012 Aug;82(2):193-6. doi: 10.1111/j.1399-0004.2011.01728.x. Epub 2011 Jun 30. 21651516
  6. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569