You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameProtein phosphatase 1 regulatory subunit 12A
Synonyms
  • MBS
  • Myosin phosphatase target subunit 1
  • Myosin phosphatase-targeting subunit 1
  • MYPT1
  • Protein phosphatase myosin-binding subunit
Gene NamePPP1R12A
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009115|Protein phosphatase 1 regulatory subunit 12A
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLL
HRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLD
IAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRD
ARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAA
HWGKEEACRILVDNLCDMEMVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKRDKKSP
LIESTANMDNNQSQKTFKNKETLIIEPEKNASRIESLEQEKVDEEEEGKKDESSCSSEED
EEDDSESEAETDKTKPLASVTNANTSSTQAAPVAVTTPTVSSGQATPTSPIKKFPTTATK
ISPKEEERKDESPATWRLGLRKTGSYGALAEITASKEGQKEKDTAGVTRSASSPRLSSSL
DNKEKEKDSKGTRLAYVAPTIPRRLASTSDIEEKENRDSSSLRTSSSYTRRKWEDDLKKN
SSVNEGSTYHKSCSFGRRQDDLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTTKITTGS
SSAGTQSSTSNRLWAEDSTEKEKDSVPTAVTIPVAPTVVNAAASTTTLTTTTAGTVSSTT
EVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTRTR
EQENEEKEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYQRYRPVSTSSSTTP
SSSLSTMSSSLYASSQLNRPNSLVGITSAYSRGITKENEREGEKREEEKEGEDKSQPKSI
RERRRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSAGDR
YDSLLGRSGSYSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDL
KLQLEKATQRQERFADRSLLEMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGA
LIRVISKLSK
Number of residues1030
Molecular Weight115279.605
Theoretical pINot Available
GO Classification
Functions
  • 14-3-3 protein binding
  • phosphatase regulator activity
  • protein kinase binding
  • signal transducer activity
  • enzyme inhibitor activity
Processes
  • negative regulation of catalytic activity
  • small GTPase mediated signal transduction
  • regulation of cell adhesion
  • positive regulation of myosin-light-chain-phosphatase activity
  • mitotic nuclear division
  • regulation of myosin-light-chain-phosphatase activity
  • positive regulation of transcription from RNA polymerase II promoter
  • regulation of nucleocytoplasmic transport
  • G2/M transition of mitotic cell cycle
  • mitotic cell cycle
  • protein dephosphorylation
  • centrosome organization
Components
  • kinetochore
  • actin cytoskeleton
  • A band
  • contractile fiber
  • cytosol
  • PTW/PP1 phosphatase complex
  • nucleoplasm
  • Z disc
  • focal adhesion
  • cytoplasm
  • centrosome
General FunctionSignal transducer activity
Specific FunctionKey regulator of protein phosphatase 1C (PPP1C). Mediates binding to myosin. As part of the PPP1C complex, involved in dephosphorylation of PLK1. Capable of inhibiting HIF1AN-dependent suppression of HIF1A activity.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDO14974
UniProtKB Entry NameMYPT1_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0013622|Protein phosphatase 1 regulatory subunit 12A (PPP1R12A)
ATGAAGATGGCGGACGCGAAGCAGAAGCGGAACGAGCAGCTGAAACGCTGGATCGGCTCC
GAGACGGACCTCGAGCCTCCGGTGGTGAAGCGCCAGAAGACCAAGGTGAAGTTCGACGAT
GGCGCCGTCTTCCTGGCTGCTTGCTCCAGCGGCGACACGGACGAGGTCCTCAAGCTGCTG
CACCGCGGCGCCGACATCAATTACGCCAATGTGGACGGACTCACTGCCCTGCACCAGGCT
TGCATTGATGACAATGTTGATATGGTGAAGTTTCTGGTAGAAAATGGAGCAAATATTAAT
CAACCTGATAATGAAGGCTGGATACCACTACATGCAGCAGCTTCCTGTGGATATCTTGAT
ATTGCAGAGTTTTTGATTGGTCAAGGAGCACATGTAGGGGCTGTCAACAGTGAAGGAGAT
ACACCTTTAGATATTGCGGAGGAGGAGGCAATGGAAGAGCTACTTCAAAATGAAGTTAAT
CGGCAAGGGGTTGATATAGAAGCAGCTCGAAAGGAAGAAGAACGGATCATGCTTAGAGAT
GCCAGGCAGTGGCTAAATAGTGGTCATATAAATGATGTCCGGCATGCAAAATCTGGAGGT
ACAGCACTTCACGTTGCAGCTGCTAAAGGCTATACGGAAGTTTTAAAACTTTTAATACAG
GCAGGCTATGATGTTAATATTAAAGACTATGATGGCTGGACACCTCTTCATGCTGCAGCT
CATTGGGGTAAAGAAGAAGCATGTCGAATTTTAGTGGACAATCTGTGTGATATGGAGATG
GTCAACAAAGTGGGCCAAACAGCCTTTGATGTAGCAGATGAAGACATTTTAGGATATTTA
GAAGAGTTGCAAAAGAAACAAAATCTGCTCCATAGTGAAAAACGGGACAAGAAATCTCCA
CTAATTGAATCAACAGCAAATATGGACAATAATCAGTCACAGAAGACCTTTAAAAACAAA
GAGACGTTGATTATTGAACCAGAGAAAAATGCATCCCGTATTGAATCTCTGGAACAAGAA
AAGGTTGATGAAGAAGAAGAAGGAAAGAAGGATGAGTCTAGCTGCTCTAGTGAAGAAGAT
GAGGAAGATGACTCGGAATCAGAAGCTGAAACAGATAAGACAAAACCCCTGGCTTCTGTA
ACTAATGCCAACACTTCTAGTACACAAGCAGCTCCTGTAGCTGTTACAACACCTACTGTG
TCATCAGGTCAAGCAACACCTACATCACCTATTAAAAAGTTTCCAACCACAGCTACAAAA
ATTTCTCCCAAAGAAGAAGAGAGAAAAGATGAGTCTCCTGCAACTTGGAGGTTAGGACTT
AGAAAGACGGGCAGCTATGGTGCACTTGCTGAAATCACAGCATCTAAAGAGGGTCAGAAA
GAAAAAGATACTGCAGGTGTTACACGTTCAGCTTCAAGTCCCAGACTTTCCTCCTCTTTG
GATAATAAAGAAAAGGAGAAAGATAGTAAAGGAACTAGGCTTGCATATGTTGCACCTACA
ATACCAAGACGACTAGCCAGTACATCTGACATTGAAGAGAAAGAAAACAGAGATTCTTCA
AGTTTGCGAACAAGTAGTTCATATACAAGGAGAAAATGGGAAGATGATCTTAAAAAAAAT
AGCTCAGTTAATGAAGGATCAACGTATCATAAAAGTTGCTCCTTTGGTAGAAGACAAGAT
GATTTGATTAGTTCTAGTGTTCCAAGCACCACATCAACACCAACAGTTACCTCTGCAGCT
GGGCTTCAGAAAAGCCTGCTTTCCAGCACAAGCACTACTACAAAGATTACAACGGGTTCT
TCCTCAGCAGGCACACAAAGCAGTACCTCAAATCGTTTGTGGGCTGAGGATAGTACTGAG
AAAGAAAAGGACAGTGTTCCTACGGCAGTGACCATTCCTGTTGCTCCAACTGTTGTAAAT
GCTGCAGCTTCTACCACAACCCTGACTACAACTACTGCTGGCACTGTCTCCTCCACAACA
GAGGTCAGGGAGAGACGCAGATCATACCTCACTCCTGTTAGGGATGAAGAGTCTGAATCC
CAAAGAAAAGCAAGATCTAGACAAGCAAGACAATCTAGAAGATCAACACAGGGAGTGACA
TTAACTGATCTTCAAGAAGCTGAGAAAACAATAGGAAGAAGTCGTTCTACCCGAACCAGA
GAACAAGAAAATGAAGAAAAAGAAAAAGAGGAAAAAGAGAAACAAGATAAAGAGAAACAA
GAAGAAAAGAAGGAGTCAGAAACATCTAGAGAAGATGAATATAAACAAAAGTACTCCAGA
ACGTATGATGAGACTTACCAGCGTTATAGGCCAGTATCAACTTCAAGTTCAACCACTCCA
TCCTCTTCACTTTCTACTATGAGCAGTTCACTGTATGCTTCAAGTCAACTAAACAGGCCA
AATAGTCTTGTAGGCATAACTTCTGCTTACTCCAGAGGAATAACAAAAGAAAATGAAAGA
GAGGGAGAAAAAAGAGAAGAGGAGAAAGAAGGAGAAGATAAATCACAACCTAAATCAATC
AGAGAACGACGACGACCAAGAGAGAAAAGAAGATCTACAGGAGTTTCATTTTGGACACAA
GATAGTGATGAAAATGAACAAGAACAACAATCAGACACAGAAGAGGGATCCAATAAGAAA
GAAACTCAGACGGATTCCATTTCTAGATATGAAACCAGTTCTACATCAGCTGGTGATCGA
TATGATTCCTTGCTGGGTCGCTCTGGATCATACAGTTACTTAGAAGAAAGAAAACCTTAC
AGCAGCAGGCTAGAAAAGGATGACTCAACTGACTTTAAAAAGCTTTATGAACAAATTCTA
GCTGAAAATGAAAAGCTGAAGGCACAGCTACATGATACAAATATGGAACTAACAGATCTT
AAATTACAGTTGGAAAAGGCCACCCAGAGACAAGAAAGATTTGCTGATAGATCACTGTTG
GAAATGGAAAAAAGGGAACGAAGAGCTCTAGAAAGAAGAATATCTGAAATGGAAGAAGAG
CTCAAAATGTTACCAGACCTAAAAGCAGACAACCAGAGGCTAAAGGATGAAAATGGGGCC
TTGATCAGAGTTATAAGCAAACTTTCCAAATAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:7618
Chromosome Location12
LocusNot Available
References
  1. Takahashi N, Ito M, Tanaka J, Nakano T, Kaibuchi K, Odai H, Takemura K: Localization of the gene coding for myosin phosphatase, target subunit 1 (MYPT1) to human chromosome 12q15-q21. Genomics. 1997 Aug 15;44(1):150-2. 9286714
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. 16541075
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Machida H, Ito M, Okamoto R, Shiraki K, Isaka N, Hartshorne DJ, Nakano T: Molecular cloning and analysis of the 5'-flanking region of the human MYPT1 gene. Biochim Biophys Acta. 2001 Feb 16;1517(3):424-9. 11342221
  6. Webb JD, Muranyi A, Pugh CW, Ratcliffe PJ, Coleman ML: MYPT1, the targeting subunit of smooth-muscle myosin phosphatase, is a substrate for the asparaginyl hydroxylase factor inhibiting hypoxia-inducible factor (FIH). Biochem J. 2009 May 13;420(2):327-33. doi: 10.1042/BJ20081905. 19245366
  7. Surks HK, Mochizuki N, Kasai Y, Georgescu SP, Tang KM, Ito M, Lincoln TM, Mendelsohn ME: Regulation of myosin phosphatase by a specific interaction with cGMP- dependent protein kinase Ialpha. Science. 1999 Nov 19;286(5444):1583-7. 10567269
  8. Muranyi A, Zhang R, Liu F, Hirano K, Ito M, Epstein HF, Hartshorne DJ: Myotonic dystrophy protein kinase phosphorylates the myosin phosphatase targeting subunit and inhibits myosin phosphatase activity. FEBS Lett. 2001 Mar 30;493(2-3):80-4. 11287000
  9. Arimura T, Suematsu N, Zhou YB, Nishimura J, Satoh S, Takeshita A, Kanaide H, Kimura A: Identification, characterization, and functional analysis of heart-specific myosin light chain phosphatase small subunit. J Biol Chem. 2001 Mar 2;276(9):6073-82. Epub 2000 Nov 6. 11067852
  10. Katoh K, Kano Y, Amano M, Onishi H, Kaibuchi K, Fujiwara K: Rho-kinase--mediated contraction of isolated stress fibers. J Cell Biol. 2001 Apr 30;153(3):569-84. 11331307
  11. Sebbagh M, Renvoize C, Hamelin J, Riche N, Bertoglio J, Breard J: Caspase-3-mediated cleavage of ROCK I induces MLC phosphorylation and apoptotic membrane blebbing. Nat Cell Biol. 2001 Apr;3(4):346-52. 11283607
  12. Broustas CG, Grammatikakis N, Eto M, Dent P, Brautigan DL, Kasid U: Phosphorylation of the myosin-binding subunit of myosin phosphatase by Raf-1 and inhibition of phosphatase activity. J Biol Chem. 2002 Jan 25;277(4):3053-9. Epub 2001 Nov 21. 11719507
  13. Surks HK, Mendelsohn ME: Dimerization of cGMP-dependent protein kinase 1alpha and the myosin-binding subunit of myosin phosphatase: role of leucine zipper domains. Cell Signal. 2003 Oct;15(10):937-44. 12873707
  14. Bannert N, Vollhardt K, Asomuddinov B, Haag M, Konig H, Norley S, Kurth R: PDZ Domain-mediated interaction of interleukin-16 precursor proteins with myosin phosphatase targeting subunits. J Biol Chem. 2003 Oct 24;278(43):42190-9. Epub 2003 Aug 14. 12923170
  15. Riento K, Guasch RM, Garg R, Jin B, Ridley AJ: RhoE binds to ROCK I and inhibits downstream signaling. Mol Cell Biol. 2003 Jun;23(12):4219-29. 12773565
  16. Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC: Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry. Anal Chem. 2004 May 15;76(10):2763-72. 15144186
  17. Wooldridge AA, MacDonald JA, Erdodi F, Ma C, Borman MA, Hartshorne DJ, Haystead TA: Smooth muscle phosphatase is regulated in vivo by exclusion of phosphorylation of threonine 696 of MYPT1 by phosphorylation of Serine 695 in response to cyclic nucleotides. J Biol Chem. 2004 Aug 13;279(33):34496-504. Epub 2004 Jun 11. 15194681
  18. Wilkinson S, Paterson HF, Marshall CJ: Cdc42-MRCK and Rho-ROCK signalling cooperate in myosin phosphorylation and cell invasion. Nat Cell Biol. 2005 Mar;7(3):255-61. Epub 2005 Feb 20. 15723050
  19. Takamoto N, Komatsu S, Komaba S, Niiro N, Ikebe M: Novel ZIP kinase isoform lacks leucine zipper. Arch Biochem Biophys. 2006 Dec 15;456(2):194-203. Epub 2006 Oct 16. 17126281
  20. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. 17081983
  21. Lee E, Hayes DB, Langsetmo K, Sundberg EJ, Tao TC: Interactions between the leucine-zipper motif of cGMP-dependent protein kinase and the C-terminal region of the targeting subunit of myosin light chain phosphatase. J Mol Biol. 2007 Nov 9;373(5):1198-212. Epub 2007 Aug 25. 17904578
  22. Yamashiro S, Yamakita Y, Totsukawa G, Goto H, Kaibuchi K, Ito M, Hartshorne DJ, Matsumura F: Myosin phosphatase-targeting subunit 1 regulates mitosis by antagonizing polo-like kinase 1. Dev Cell. 2008 May;14(5):787-97. doi: 10.1016/j.devcel.2008.02.013. 18477460
  23. Sharma AK, Zhou GP, Kupferman J, Surks HK, Christensen EN, Chou JJ, Mendelsohn ME, Rigby AC: Probing the interaction between the coiled coil leucine zipper of cGMP-dependent protein kinase Ialpha and the C terminus of the myosin binding subunit of the myosin light chain phosphatase. J Biol Chem. 2008 Nov 21;283(47):32860-9. doi: 10.1074/jbc.M804916200. Epub 2008 Sep 9. 18782776
  24. Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J: Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment. J Proteome Res. 2008 Dec;7(12):5167-76. 19367720
  25. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. 18088087
  26. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  27. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  28. Wang Y, Zheng XR, Riddick N, Bryden M, Baur W, Zhang X, Surks HK: ROCK isoform regulation of myosin phosphatase and contractility in vascular smooth muscle cells. Circ Res. 2009 Feb 27;104(4):531-40. doi: 10.1161/CIRCRESAHA.108.188524. Epub 2009 Jan 8. 19131646
  29. Lock FE, Hotchin NA: Distinct roles for ROCK1 and ROCK2 in the regulation of keratinocyte differentiation. PLoS One. 2009 Dec 4;4(12):e8190. doi: 10.1371/journal.pone.0008190. 19997641
  30. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  31. Zagorska A, Deak M, Campbell DG, Banerjee S, Hirano M, Aizawa S, Prescott AR, Alessi DR: New roles for the LKB1-NUAK pathway in controlling myosin phosphatase complexes and cell adhesion. Sci Signal. 2010 Mar 30;3(115):ra25. doi: 10.1126/scisignal.2000616. 20354225
  32. Lontay B, Bodoor K, Weitzel DH, Loiselle D, Fortner C, Lengyel S, Zheng D, Devente J, Hickner R, Haystead TA: Smoothelin-like 1 protein regulates myosin phosphatase-targeting subunit 1 expression during sexual development and pregnancy. J Biol Chem. 2010 Sep 17;285(38):29357-66. doi: 10.1074/jbc.M110.143966. Epub 2010 Jul 15. 20634291
  33. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  34. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  35. Tan I, Lai J, Yong J, Li SF, Leung T: Chelerythrine perturbs lamellar actomyosin filaments by selective inhibition of myotonic dystrophy kinase-related Cdc42-binding kinase. FEBS Lett. 2011 May 6;585(9):1260-8. doi: 10.1016/j.febslet.2011.03.054. Epub 2011 Mar 30. 21457715
  36. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  37. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. 22814378
  38. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  39. Mori S, Iwaoka R, Eto M, Ohki SY: Solution structure of the inhibitory phosphorylation domain of myosin phosphatase targeting subunit 1. Proteins. 2009 Nov 15;77(3):732-5. doi: 10.1002/prot.22529. 19701943