You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMetabotropic glutamate receptor 6
Synonyms
  • GPRC1F
  • MGLUR6
Gene NameGRM6
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013738|Metabotropic glutamate receptor 6
MARPRRAREPLLVALLPLAWLAQAGLARAAGSVRLAGGLTLGGLFPVHARGAAGRACGQL
KKEQGVHRLEAMLYALDRVNADPELLPGVRLGARLLDTCSRDTYALEQALSFVQALIRGR
GDGDEVGVRCPGGVPPLRPAPPERVVAVVGASASSVSIMVANVLRLFAIPQISYASTAPE
LSDSTRYDFFSRVVPPDSYQAQAMVDIVRALGWNYVSTLASEGNYGESGVEAFVQISREA
GGVCIAQSIKIPREPKPGEFSKVIRRLMETPNARGIIIFANEDDIRRVLEAARQANLTGH
FLWVGSDSWGAKTSPILSLEDVAVGAITILPKRASIDGFDQYFMTRSLENNRRNIWFAEF
WEENFNCKLTSSGTQSDDSTRKCTGEERIGRDSTYEQEGKVQFVIDAVYAIAHALHSMHQ
ALCPGHTGLCPAMEPTDGRMLLQYIRAVRFNGSAGTPVMFNENGDAPGRYDIFQYQATNG
SASSGGYQAVGQWAETLRLDVEALQWSGDPHEVPSSLCSLPCGPGERKKMVKGVPCCWHC
EACDGYRFQVDEFTCEACPGDMRPTPNHTGCRPTPVVRLSWSSPWAAPPLLLAVLGIVAT
TTVVATFVRYNNTPIVRASGRELSYVLLTGIFLIYAITFLMVAEPGAAVCAARRLFLGLG
TTLSYSALLTKTNRIYRIFEQGKRSVTPPPFISPTSQLVITFSLTSLQVVGMIAWLGARP
PHSVIDYEEQRTVDPEQARGVLKCDMSDLSLIGCLGYSLLLMVTCTVYAIKARGVPETFN
EAKPIGFTMYTTCIIWLAFVPIFFGTAQSAEKIYIQTTTLTVSLSLSASVSLGMLYVPKT
YVILFHPEQNVQKRKRSLKATSTVAAPPKGEDAEAHK
Number of residues877
Molecular Weight95466.77
Theoretical pINot Available
GO Classification
Functions
  • G-protein coupled receptor activity
  • group III metabotropic glutamate receptor activity
  • glutamate receptor activity
  • protein homodimerization activity
Processes
  • detection of light stimulus involved in visual perception
  • detection of visible light
  • synaptic transmission
  • locomotory behavior
  • positive regulation of calcium ion import
  • retina development in camera-type eye
  • regulation of synaptic transmission, glutamatergic
  • G-protein coupled glutamate receptor signaling pathway
  • adenylate cyclase-inhibiting G-protein coupled glutamate receptor signaling pathway
Components
  • plasma membrane
  • new growing cell tip
  • endoplasmic reticulum membrane
  • integral component of plasma membrane
  • Golgi membrane
  • dendrite
  • presynaptic membrane
General FunctionProtein homodimerization activity
Specific FunctionG-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity (By similarity). Signaling stimulates TRPM1 channel activity and Ca(2+) uptake. Required for normal vision.
Pfam Domain Function
Transmembrane Regions586-608 623-643 655-673 698-718 749-770 784-806 820-845
GenBank Protein IDNot Available
UniProtKB IDO15303
UniProtKB Entry NameGRM6_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0013739|Metabotropic glutamate receptor 6 (GRM6)
ATGGCGCGGCCCCGGAGAGCCCGGGAGCCGCTGCTCGTGGCGCTGCTGCCGCTGGCGTGG
CTGGCGCAGGCGGGCCTGGCGCGCGCGGCGGGCTCTGTGCGCCTGGCGGGCGGCCTGACG
CTGGGCGGCCTGTTCCCGGTGCACGCGCGGGGCGCGGCGGGCCGGGCGTGCGGGCAGCTG
AAGAAGGAGCAGGGCGTGCACCGGCTGGAGGCCATGCTGTACGCGCTGGACCGCGTCAAC
GCCGACCCCGAGCTGCTGCCCGGCGTGCGCCTGGGCGCGCGGCTGCTGGACACCTGCTCG
CGGGACACCTACGCGCTGGAGCAGGCGCTGAGCTTCGTGCAGGCGCTGATCCGCGGCCGC
GGCGACGGCGACGAGGTGGGCGTGCGCTGCCCGGGAGGCGTCCCTCCGCTGCGCCCCGCG
CCCCCCGAGCGCGTCGTGGCCGTCGTGGGCGCCTCGGCCAGCTCCGTCTCCATCATGGTC
GCCAACGTGCTGCGCCTGTTTGCGATACCCCAGATCAGCTATGCCTCCACAGCCCCGGAG
CTCAGCGACTCCACACGCTATGACTTCTTCTCCCGGGTGGTGCCACCCGACTCCTACCAG
GCGCAGGCCATGGTGGACATCGTGAGGGCACTGGGATGGAACTATGTGTCCACGCTGGCC
TCCGAGGGCAACTATGGCGAAAGTGGGGTTGAGGCCTTCGTTCAGATCTCCCGAGAGGCT
GGGGGGGTCTGTATTGCCCAGTCTATCAAGATTCCCAGGGAACCAAAGCCAGGAGAGTTC
AGCAAGGTGATCAGGAGACTCATGGAGACGCCCAACGCCCGGGGCATCATCATCTTTGCC
AATGAGGATGACATCAGGCGGGTCCTGGAGGCAGCTCGCCAGGCCAACCTGACCGGCCAC
TTCCTGTGGGTCGGCTCAGACAGCTGGGGAGCCAAGACCTCACCCATCTTGAGCCTGGAG
GACGTGGCCGTTGGGGCCATCACCATCCTGCCCAAAAGGGCCTCCATCGACGGATTTGAC
CAGTACTTCATGACTCGATCCCTGGAGAACAACCGCAGGAACATCTGGTTCGCCGAGTTC
TGGGAAGAGAATTTTAACTGCAAACTGACCAGCTCAGGTACCCAGTCAGACGATTCCACC
CGCAAATGCACAGGCGAGGAACGCATCGGCCGGGACTCCACCTACGAGCAGGAGGGCAAG
GTGCAGTTTGTGATTGATGCGGTGTACGCCATTGCCCACGCCCTCCACAGCATGCACCAG
GCGCTCTGCCCTGGGCACACAGGCCTGTGCCCGGCGATGGAACCCACTGATGGGCGGATG
CTTCTGCAGTACATTCGAGCTGTCCGCTTCAATGGCAGCGCAGGAACCCCTGTGATGTTC
AACGAGAACGGAGATGCGCCCGGGCGGTACGACATCTTCCAGTACCAGGCGACCAATGGC
AGTGCCAGCAGTGGCGGGTACCAGGCAGTGGGCCAGTGGGCAGAGACCCTCAGACTGGAT
GTGGAGGCCCTGCAGTGGTCTGGCGACCCCCACGAGGTGCCCTCGTCTCTGTGCAGCCTG
CCCTGCGGGCCGGGGGAGCGGAAGAAGATGGTGAAGGGCGTCCCCTGCTGTTGGCACTGC
GAGGCCTGTGACGGGTACCGCTTCCAGGTGGACGAGTTCACATGCGAGGCCTGTCCTGGG
GACATGAGGCCCACGCCCAACCACACGGGCTGCCGCCCCACACCTGTGGTGCGCCTGAGC
TGGTCCTCCCCCTGGGCAGCCCCGCCGCTCCTCCTGGCCGTGCTGGGCATCGTGGCCACT
ACCACGGTGGTGGCCACCTTCGTGCGGTACAACAACACGCCCATCGTCCGGGCCTCGGGC
CGAGAGCTCAGCTACGTCCTCCTCACCGGCATCTTCCTCATCTACGCCATCACCTTCCTC
ATGGTGGCTGAGCCTGGGGCCGCGGTCTGTGCCGCCCGCAGGCTCTTCCTGGGCCTGGGC
ACGACCCTCAGCTACTCTGCCCTGCTCACCAAGACCAACCGTATCTACCGCATCTTTGAG
CAGGGCAAGCGCTCGGTCACACCCCCTCCCTTCATCAGCCCCACCTCACAGCTGGTCATC
ACCTTCAGCCTCACCTCCCTGCAGGTGGTGGGGATGATAGCATGGCTGGGGGCCCGGCCC
CCACACAGCGTGATTGACTATGAGGAACAGCGGACGGTGGACCCCGAGCAGGCCAGAGGG
GTGCTCAAGTGCGACATGTCGGATCTGTCTCTCATCGGCTGCCTGGGCTACAGCCTCCTG
CTCATGGTCACGTGCACAGTGTACGCCATCAAGGCCCGTGGCGTGCCCGAGACCTTCAAC
GAGGCCAAGCCCATCGGCTTCACCATGTACACCACCTGCATCATCTGGCTGGCATTCGTG
CCCATCTTCTTTGGCACTGCCCAGTCAGCTGAAAAGATCTACATCCAGACAACCACGCTA
ACCGTGTCCTTGAGCCTGAGTGCCTCGGTGTCCCTCGGCATGCTCTACGTACCCAAAACC
TACGTCATCCTCTTCCATCCAGAGCAGAATGTGCAGAAGCGAAAGCGGAGCCTCAAGGCC
ACCTCCACGGTGGCAGCCCCACCCAAGGGCGAGGATGCAGAGGCCCACAAGTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:4598
Chromosome Location5
LocusNot Available
References
  1. Hashimoto T, Inazawa J, Okamoto N, Tagawa Y, Bessho Y, Honda Y, Nakanishi S: The whole nucleotide sequence and chromosomal localization of the gene for human metabotropic glutamate receptor subtype 6. Eur J Neurosci. 1997 Jun;9(6):1226-35. 9215706
  2. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. 15372022
  3. Devi S, Markandeya Y, Maddodi N, Dhingra A, Vardi N, Balijepalli RC, Setaluri V: Metabotropic glutamate receptor 6 signaling enhances TRPM1 calcium channel function and increases melanin content in human melanocytes. Pigment Cell Melanoma Res. 2013 May;26(3):348-56. doi: 10.1111/pcmr.12083. Epub 2013 Mar 27. 23452348
  4. Dryja TP, McGee TL, Berson EL, Fishman GA, Sandberg MA, Alexander KR, Derlacki DJ, Rajagopalan AS: Night blindness and abnormal cone electroretinogram ON responses in patients with mutations in the GRM6 gene encoding mGluR6. Proc Natl Acad Sci U S A. 2005 Mar 29;102(13):4884-9. Epub 2005 Mar 21. 15781871
  5. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974
  6. Zeitz C, Forster U, Neidhardt J, Feil S, Kalin S, Leifert D, Flor PJ, Berger W: Night blindness-associated mutations in the ligand-binding, cysteine-rich, and intracellular domains of the metabotropic glutamate receptor 6 abolish protein trafficking. Hum Mutat. 2007 Aug;28(8):771-80. 17405131
  7. Bijveld MM, Florijn RJ, Bergen AA, van den Born LI, Kamermans M, Prick L, Riemslag FC, van Schooneveld MJ, Kappers AM, van Genderen MM: Genotype and phenotype of 101 dutch patients with congenital stationary night blindness. Ophthalmology. 2013 Oct;120(10):2072-81. doi: 10.1016/j.ophtha.2013.03.002. Epub 2013 May 25. 23714322