You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameCationic amino acid transporter 4
Synonyms
  • CAT-4
  • Solute carrier family 7 member 4
Gene NameSLC7A4
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009904|Cationic amino acid transporter 4
MARGLPTIASLARLCQKLNRLKPLEDSTMETSLRRCLSTLDLTLLGVGGMVGSGLYVLTG
AVAKEVAGPAVLLSFGVAAVASLLAALCYAEFGARVPRTGSAYLFTYVSMGELWAFLIGW
NVLLEYIIGGAAVARAWSGYLDSMFSHSIRNFTETHVGSWQVPLLGHYPDFLAAGIILLA
SAFVSCGARVSSWLNHTFSAISLLVILFIVILGFILAQPHNWSADEGGFAPFGFSGVMAG
TASCFYAFVGFDVIAASSEEAQNPRRSVPLAIAISLAIAAGAYILVSTVLTLMVPWHSLD
PDSALADAFYQRGYRWAGFIVAAGSICAMNTVLLSLLFSLPRIVYAMAADGLFFQVFAHV
HPRTQVPVAGTLAFGLLTAFLALLLDLESLVQFLSLGTLLAYTFVATSIIVLRFQKSSPP
SSPGPASPGPLTKQQSSFSDHLQLVGTVHASVPEPGELKPALRPYLGFLDGYSPGAVVTW
ALGVMLASAITIGCVLVFGNSTLHLPHWGYILLLLLTSVMFLLSLLVLGAHQQQYREDLF
QIPMVPLIPALSIVLNICLMLKLSYLTWVRFSIWLLMGLAVYFGYGIRHSKENQRELPGL
NSTHYVVFPRGSLEETVQAMQPPSQAPAQDPGHME
Number of residues635
Molecular Weight68267.17
Theoretical pI7.08
GO Classification
Functions
  • L-lysine transmembrane transporter activity
  • L-ornithine transmembrane transporter activity
  • antiporter activity
  • arginine transmembrane transporter activity
  • basic amino acid transmembrane transporter activity
Processes
  • basic amino acid transmembrane transport
  • L-arginine import across plasma membrane
  • L-lysine transmembrane transport
  • L-ornithine transmembrane transport
  • transport
  • cellular amino acid metabolic process
Components
  • integral component of membrane
  • integral component of plasma membrane
General FunctionL-ornithine transmembrane transporter activity
Specific FunctionInvolved in the transport of the cationic amino acids (arginine, lysine and ornithine).
Pfam Domain Function
Transmembrane Regions42-62 66-86 113-133 197-217 229-249 270-290 318-338 365-385 391-411 478-498 508-528 539-559 567-587
GenBank Protein ID4378940
UniProtKB IDO43246
UniProtKB Entry NameCTR4_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0009905|Cationic amino acid transporter 4 (SLC7A4)
ATGGCCCGGGGGCTGCCCACCATTGCTAGCCTGGCACGCTTATGCCAGAAGCTGAACCGC
CTGAAGCCGCTGGAGGACTCCACCATGGAGACGTCACTGCGGCGCTGCCTGTCCACGCTG
GACCTGACTCTTCTGGGCGTGGGTGGCATGGTGGGCTCGGGTCTCTACGTGCTCACAGGT
GCCGTGGCCAAGGAGGTGGCTGGCCCTGCTGTGCTCTTGTCCTTCGGTGTGGCCGCTGTG
GCCTCCCTGCTGGCAGCCCTATGCTATGCAGAATTTGGGGCACGTGTGCCACGCACGGGC
TCTGCCTACCTGTTCACCTACGTATCCATGGGCGAGCTGTGGGCCTTCCTCATCGGCTGG
AATGTTCTCCTCGAATACATCATCGGTGGCGCCGCCGTGGCCCGTGCCTGGAGTGGCTAC
CTGGACTCTATGTTCAGCCACAGCATCCGCAACTTCACTGAGACCCACGTGGGTTCTTGG
CAGGTGCCCCTCCTGGGCCACTACCCGGACTTCCTGGCTGCTGGCATCATCCTCCTGGCC
TCTGCCTTTGTCTCCTGTGGAGCCCGCGTGTCCTCCTGGCTCAATCACACCTTCTCGGCC
ATCAGCCTGCTTGTCATTCTCTTCATTGTCATCCTGGGCTTCATCCTGGCCCAGCCTCAC
AACTGGAGCGCTGACGAAGGCGGCTTTGCACCCTTCGGCTTCTCCGGCGTCATGGCCGGC
ACTGCCTCCTGCTTCTATGCTTTCGTGGGCTTCGACGTCATTGCCGCCTCCAGTGAGGAG
GCCCAGAACCCACGGCGGTCTGTGCCTCTGGCCATCGCCATCTCGCTTGCCATTGCAGCT
GGTGCCTACATCCTTGTCTCCACCGTGCTAACCCTCATGGTGCCCTGGCACAGCCTGGAC
CCCGACTCAGCGCTTGCAGATGCCTTCTACCAGCGGGGCTACAGGTGGGCTGGCTTCATC
GTGGCAGCTGGCTCCATCTGCGCCATGAACACCGTCCTGCTCAGCCTCCTCTTCTCCCTG
CCACGCATTGTCTATGCCATGGCCGCCGATGGGCTCTTCTTCCAGGTGTTTGCCCATGTG
CACCCCCGGACACAGGTGCCTGTGGCGGGCACCCTGGCGTTCGGGCTCCTCACGGCCTTC
CTGGCACTGCTGCTGGACCTGGAGTCGCTGGTTCAGTTCCTGTCCCTTGGCACACTCCTG
GCCTACACATTCGTGGCCACCAGTATCATTGTGCTGCGCTTCCAGAAGTCTTCCCCGCCC
AGCTCCCCAGGCCCAGCCAGCCCTGGCCCCCTGACCAAGCAGCAGAGCTCCTTCTCAGAC
CACCTACAGCTGGTGGGCACTGTACACGCCTCCGTCCCTGAGCCAGGGGAGCTGAAGCCA
GCCCTGAGGCCCTACCTGGGCTTCTTGGATGGGTACAGCCCTGGAGCAGTGGTGACTTGG
GCGCTTGGCGTTATGTTGGCCTCAGCCATCACCATAGGCTGCGTGCTTGTCTTTGGGAAC
TCGACCCTGCACCTCCCACACTGGGGTTACATCCTGCTGCTCCTGCTCACCAGTGTCATG
TTTCTGCTCAGCCTCCTTGTCCTGGGGGCTCACCAGCAACAGTATCGGGAAGACTTATTT
CAGATCCCCATGGTTCCCCTGATTCCAGCCCTGAGCATCGTCCTCAACATCTGCCTCATG
CTGAAACTTAGCTATCTGACCTGGGTGCGCTTCTCCATCTGGCTGCTGATGGGACTTGCA
GTGTATTTCGGCTATGGCATCCGGCATAGCAAGGAGAACCAGCGGGAGCTGCCAGGGCTG
AACTCCACACACTACGTGGTATTCCCCAGGGGCAGCCTGGAGGAGACAGTGCAGGCTATG
CAGCCCCCCAGCCAGGCACCAGCACAGGACCCTGGCCATATGGAGTAG
GenBank Gene IDAJ000730
GeneCard IDNot Available
GenAtlas IDSLC7A4
HGNC IDHGNC:11062
Chromosome Location22
Locus22q11.21
References
  1. Sperandeo MP, Borsani G, Incerti B, Zollo M, Rossi E, Zuffardi O, Castaldo P, Taglialatela M, Andria G, Sebastio G: The gene encoding a cationic amino acid transporter (SLC7A4) maps to the region deleted in the velocardiofacial syndrome. Genomics. 1998 Apr 15;49(2):230-6. 9598310
  2. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. 15461802
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334