You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameAquaporin-9
Synonyms
  • AQP-9
  • Aquaglyceroporin-9
  • Small solute channel 1
  • SSC1
Gene NameAQP9
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013425|Aquaporin-9
MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITI
NVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATV
FGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIF
DSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAG
NNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM
Number of residues295
Molecular Weight31430.77
Theoretical pINot Available
GO Classification
Functions
  • amine transmembrane transporter activity
  • porin activity
  • glycerol channel activity
  • water channel activity
  • urea transmembrane transporter activity
  • water transmembrane transporter activity
  • carboxylic acid transmembrane transporter activity
  • polyol transmembrane transporter activity
  • purine nucleobase transmembrane transporter activity
  • pyrimidine nucleobase transmembrane transporter activity
Processes
  • carboxylic acid transport
  • polyol transport
  • metabolic process
  • water homeostasis
  • cellular water homeostasis
  • transmembrane transport
  • glycerol transport
  • ion transmembrane transport
  • urea transmembrane transport
  • purine nucleobase transport
  • excretion
  • pyrimidine nucleobase transport
  • pyrimidine-containing compound transmembrane transport
  • water transport
  • response to osmotic stress
  • response to mercury ion
  • cellular response to cAMP
  • transport
  • amine transport
  • response to organic substance
  • immune response
  • canalicular bile acid transport
Components
  • plasma membrane
  • integral component of membrane
  • integral component of plasma membrane
  • intracellular membrane-bounded organelle
  • basolateral plasma membrane
General FunctionWater transmembrane transporter activity
Specific FunctionForms a channel with a broad specificity. Mediates passage of a wide variety of non-charged solutes including carbamides, polyols, purines, and pyrimidines in a phloretin- and mercury-sensitive manner, whereas amino acids, cyclic sugars, Na(+), K(+), Cl(-), and deprotonated monocarboxylates are excluded. Also permeable to urea and glycerol.
Pfam Domain Function
Transmembrane Regions30-50 55-75 111-131 159-179 190-210 246-266
GenBank Protein IDNot Available
UniProtKB IDO43315
UniProtKB Entry NameAQP9_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0013426|Aquaporin-9 (AQP9)
ATGCAGCCTGAGGGAGCAGAAAAGGGAAAAAGCTTCAAGCAGAGACTGGTCTTGAAGAGC
AGCTTAGCGAAAGAAACCCTCTCTGAGTTCTTGGGCACGTTCATCTTGATTGTCCTTGGA
TGTGGCTGTGTTGCCCAAGCTATTCTCAGTCGAGGACGTTTTGGAGGGGTCATCACTATC
AATGTTGGATTTTCAATGGCAGTTGCAATGGCCATTTATGTGGCTGGCGGTGTCTCTGGT
GGTCACATCAACCCAGCTGTGTCTTTAGCAATGTGTCTCTTTGGACGGATGAAATGGTTC
AAATTGCCATTTTATGTGGGAGCCCAGTTCTTGGGAGCCTTTGTGGGGGCTGCAACCGTC
TTTGGCATTTACTATGATGGACTTATGTCCTTTGCTGGTGGAAAACTGCTGATCGTGGGA
GAAAATGCAACAGCACACATTTTTGCAACATACCCAGCTCCGTATCTATCTCTGGCGAAC
GCATTTGCAGATCAAGTGGTGGCCACCATGATACTCCTCATAATCGTCTTTGCCATCTTT
GACTCCAGAAACTTGGGAGCCCCCAGAGGCCTAGAGCCCATTGCCATCGGCCTCCTGATT
ATTGTCATTGCTTCCTCCCTGGGACTGAACAGTGGCTGTGCCATGAACCCAGCTCGAGAC
CTGAGTCCCAGACTTTTCACTGCCTTGGCAGGCTGGGGGTTTGAAGTCTTCAGAGCTGGA
AACAACTTCTGGTGGATTCCTGTAGTGGGCCCTTTGGTTGGTGCTGTCATTGGAGGCCTC
ATCTATGTTCTTGTCATTGAAATCCACCATCCAGAGCCTGACTCAGTCTTTAAGACAGAA
CAATCTGAGGACAAACCAGAGAAATATGAACTCAGTGTCATCATGTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:643
Chromosome Location15
LocusNot Available
References
  1. Ishibashi K, Kuwahara M, Gu Y, Tanaka Y, Marumo F, Sasaki S: Cloning and functional expression of a new aquaporin (AQP9) abundantly expressed in the peripheral leukocytes permeable to water and urea, but not to glycerol. Biochem Biophys Res Commun. 1998 Mar 6;244(1):268-74. 9514918
  2. Tsukaguchi H, Weremowicz S, Morton CC, Hediger MA: Functional and molecular characterization of the human neutral solute channel aquaporin-9. Am J Physiol. 1999 Nov;277(5 Pt 2):F685-96. 10564231
  3. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. 16572171
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334