You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGlutamate receptor ionotropic, delta-2
Synonyms
  • GluD2
  • GLURD2
Gene NameGRID2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037184|Glutamate receptor ionotropic, delta-2
MEVFPFLLVLSVWWSRTWDSANADSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQT
EKITFSVTFVDGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQ
RSTAGTPRSGCGLTRSNRNDDYTLSVRPPVYLHDVILRVVTEYAWQKFIIFYDSEYDIRG
IQEFLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAK
SFITEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFR
GNHRISSTLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNS
KPWQGGRSMLETIKKGGVSGLTGELEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWN
PVTGLNGSLTDKKLENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSN
YLGFNYEIYVAPDHKYGSPQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRY
MDYSVGVLLRRAEKTVDMFACLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSM
TSTTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITR
IESSIQSLQDLSKQTEIPYGTVLDSAVYEHVRMKGLNPFERDSMYSQMWRMINRSNGSEN
NVLESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTIGNTVADRGYGIALQHGSPY
RDVFSQRILELQQNGDMDILKHKWWPKNGQCDLYSSVDTKQKGGALDIKSFAGVFCILAA
GIVLSCFIAMLETWWNKRKGSRVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSI
DLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEH
RTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
Number of residues1007
Molecular Weight113355.16
Theoretical pI5.95
GO Classification
Functions
  • PDZ domain binding
  • scaffold protein binding
  • extracellular-glutamate-gated ion channel activity
  • glutamate receptor activity
  • ionotropic glutamate receptor activity
Processes
  • regulation of neuron projection development
  • ion transmembrane transport
  • cerebellar granule cell differentiation
  • regulation of neuron apoptotic process
  • excitatory postsynaptic potential
  • glutamate receptor signaling pathway
  • transport
  • synaptic transmission, glutamatergic
  • ionotropic glutamate receptor signaling pathway
  • heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
  • prepulse inhibition
  • cellular protein localization
Components
  • dendrite
  • synapse
  • dendritic spine
  • postsynaptic membrane
  • plasma membrane
  • cell junction
  • ionotropic glutamate receptor complex
  • integral component of plasma membrane
General FunctionScaffold protein binding
Specific FunctionReceptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists.
Pfam Domain Function
Transmembrane Regions567-587 636-656 831-851
GenBank Protein ID2853315
UniProtKB IDO43424
UniProtKB Entry NameGRID2_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0021325|Glutamate receptor ionotropic, delta-2 (GRID2)
ATGGAAGTTTTCCCCTTTCTCTTGGTTTTGTCCGTCTGGTGGTCTCGAACCTGGGACTCG
GCGAATGCGGATTCGATCATTCACATCGGAGCAATTTTTGATGAATCTGCCAAAAAGGAT
GATGAGGTATTTCGCACTGCGGTTGGTGACCTTAACCAGAATGAGGAGATCTTACAGACT
GAGAAAATCACATTTTCAGTGACGTTTGTTGATGGCAACAACCCTTTCCAAGCAGTTCAA
GAAGATATCCGTGGAATACAGGAGTTCTTGGACAAAGTCTCTCAGCAGGGAATGGATGTT
GCACTTCAGAAGGTAGAAAACAACATCAATAAAATGATTACCACTCTCTTTGACACCATG
AGAATAGAAGAACTGAATCGCTATCGAGACACTCTTAGGCGAGCGATCCTTGTTATGAAT
CCTGCTACAGCCAAATCCTTCATTACTGAGGTTGTGGAGACTAATTTGGTTGCTTTTGAC
TGTCACTGGATCATTATAAATGAGGAAATAAACGATGTGGACGTACAGGAACTTGTAAGA
AGGTCAATTGGAAGGTTAACGATTATTCGGCAGACATTTCCAGTTCCCCAGAACATAAGT
CAGCGGTGTTTCCGTGGCAACCATCGAATATCTTCAACATTGTGTGATCCAAAGGATCCA
TTTGCTCAGAATATGGAGATTTCCAACCTTTACATATATGACACGGTGCTTCTGCTTGCT
AATGCTTTTCATAAGAAGCTGGAGGACCGAAAGTGGCACAGCATGGCAAGTCTGTCATGT
ATCAGAAAGAACTCAAAGCCCTGGCAGGGTGGGCGCTCCATGTTGGAGACCATCAAGAAG
GGTGGAGTTAGTGGGTTGACTGGAGAGCTAGAATTTGGAGAAAATGGAGGCAATCCCAAT
GTCCACTTTGAAATCCTTGGAACCAACTATGGAGAAGAGCTTGGCAGAGGTGTTCGAAAA
CTTGGTTGCTGGAATCCTGTCACAGGTCTGAATGGGTCACTGACTGACAAGAAATTGGAG
AATAACATGCGTGGAGTGGTTCTACGTGTAGTAACTGTTCTGGAAGAACCTTTTGTGATG
GTCTCTGAAAATGTCTTGGGTAAGCCGAAGAAATACCAGGGCTTCTCCATTGATGTTTTG
GATGCCTTATCTAACTACCTGGGTTTTAACTACGAAATTTACGTAGCACCGGATCACAAA
TACGGAAGCCCACAAGAAGATGGGACATGGAATGGCTTGGTAGGAGAACTTGTCTTTAAG
AGAGCCGACATAGGGATTTCTGCTTTAACCATCACTCCAGATCGTGAAAATGTGGTGGAC
TTTACGACACGTTACATGGACTACTCAGTGGGGGTACTACTTCGAAGGGCTGAAAAGACA
GTGGATATGTTTGCCTGTCTTGCACCATTTGATCTCTCTCTATGGGCTTGCATTGCTGGC
ACAGTCCTTCTGGTGGGTCTACTGGTCTACCTCTTGAACTGGCTTAATCCCCCACGATTA
CAAATGGGATCAATGACGTCTACTACTCTCTACAACTCCATGTGGTTTGTGTATGGATCT
TTTGTACAACAAGGCGGGGAAGTCCCGTACACGACTCTGGCTACCCGAATGATGATGGGG
GCTTGGTGGCTATTTGCTTTGATTGTTATCTCATCTTACACGGCAAACCTCGCTGCTTTC
CTCACTATTACACGCATTGAAAGTTCCATCCAGTCTCTCCAGGACCTTTCCAAGCAAACA
GAAATCCCTTATGGCACAGTCCTAGACTCTGCGGTATATGAGCATGTCCGCATGAAAGGA
CTGAATCCTTTTGAGAGGGACAGCATGTATTCCCAAATGTGGCGGATGATCAACCGAAGC
AATGGATCGGAGAACAATGTTCTGGAGTCCCAGGCAGGCATTCAAAAGGTAAAATATGGA
AATTATGCTTTCGTATGGGATGCAGCTGTATTGGAATATGTGGCTATCAATGACCCAGAT
TGTTCCTTTTACACCATTGGAAATACTGTTGCTGATCGGGGATATGGAATTGCATTACAA
CATGGCAGTCCTTACCGAGATGTTTTTTCACAAAGGATCCTGGAGCTTCAGCAGAATGGT
GACATGGACATCCTGAAGCACAAATGGTGGCCTAAGAATGGCCAGTGTGACCTGTACTCG
TCAGTGGACACAAAGCAGAAAGGAGGCGCCCTGGACATAAAGAGCTTTGCAGGGGTCTTT
TGTATCCTGGCTGCTGGAATTGTCCTCTCCTGCTTCATAGCCATGCTGGAGACGTGGTGG
AACAAGAGGAAAGGCTCCCGGGTTCCATCAAAAGAGGATGACAAGGAAATTGACCTGGAG
CACCTCCATAGACGTGTAAATAGCTTGTGCACAGATGACGACAGCCCCCATAAACAGTTT
TCCACCTCGTCAATTGATTTGACCCCTCTGGACATTGACACTTTGCCAACACGACAAGCA
CTGGAGCAAATCAGTGATTTCAGGAACACTCATATTACCACAACAACCTTTATCCCAGAG
CAGATCCAGACTCTTAGCCGCACACTGTCAGCTAAAGCTGCTTCTGGTTTCACTTTTGGC
AACGTGCCTGAGCACCGAACTGGCCCTTTTAGGCACAGGGCACCTAATGGGGGCTTTTTC
AGGAGTCCTATAAAAACAATGTCATCTATTCCTTATCAACCAACTCCTACCCTGGGGCTC
AATCTGGGTAATGATCCAGACCGAGGCACCTCCATATGA
GenBank Gene IDAF009014
GeneCard IDNot Available
GenAtlas IDGRID2
HGNC IDHGNC:4576
Chromosome Location4
Locus4q22
References
  1. Hu W, Zuo J, De Jager PL, Heintz N: The human glutamate receptor delta 2 gene (GRID2) maps to chromosome 4q22. Genomics. 1998 Jan 1;47(1):143-5. 9465309
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. 15815621
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Utine GE, Haliloglu G, Salanci B, Cetinkaya A, Kiper PO, Alanay Y, Aktas D, Boduroglu K, Alikasifoglu M: A homozygous deletion in GRID2 causes a human phenotype with cerebellar ataxia and atrophy. J Child Neurol. 2013 Jul;28(7):926-32. doi: 10.1177/0883073813484967. Epub 2013 Apr 22. 23611888
  5. Hills LB, Masri A, Konno K, Kakegawa W, Lam AT, Lim-Melia E, Chandy N, Hill RS, Partlow JN, Al-Saffar M, Nasir R, Stoler JM, Barkovich AJ, Watanabe M, Yuzaki M, Mochida GH: Deletions in GRID2 lead to a recessive syndrome of cerebellar ataxia and tonic upgaze in humans. Neurology. 2013 Oct 15;81(16):1378-86. doi: 10.1212/WNL.0b013e3182a841a3. Epub 2013 Sep 27. 24078737
  6. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974
  7. Coutelier M, Burglen L, Mundwiller E, Abada-Bendib M, Rodriguez D, Chantot-Bastaraud S, Rougeot C, Cournelle MA, Milh M, Toutain A, Bacq D, Meyer V, Afenjar A, Deleuze JF, Brice A, Heron D, Stevanin G, Durr A: GRID2 mutations span from congenital to mild adult-onset cerebellar ataxia. Neurology. 2015 Apr 28;84(17):1751-9. doi: 10.1212/WNL.0000000000001524. Epub 2015 Apr 3. 25841024