You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameVoltage-dependent T-type calcium channel subunit alpha-1G
Synonyms
  • Cav3.1c
  • KIAA1123
  • NBR13
  • Voltage-gated calcium channel subunit alpha Cav3.1
Gene NameCACNA1G
OrganismHuman
Amino acid sequence
>lcl|BSEQ0000964|Voltage-dependent T-type calcium channel subunit alpha-1G
MDEEEDGAGAEESGQPRSFMRLNDLSGAGGRPGPGSAEKDPGSADSEAEGLPYPALAPVV
FFYLSQDSRPRSWCLRTVCNPWFERISMLVILLNCVTLGMFRPCEDIACDSQRCRILQAF
DDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVR
TVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNR
CFLPENFSLPLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLRGDGGGGPPCGL
DYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEGWVDIM
YFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNA
STLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQPSS
SCSRSHRRLSVHHLVHHHHHHHHHYHLGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTP
ALSGAPPGGAESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPE
TLKEKALVEVAASSGPPTLTSLNIPPGPYSSMHKLLETQSTGACQSSCKISSPCLKADSG
ACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQHSDLRDPHSRRQRSLGPDA
EPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNALEISNI
VFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMR
VLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTL
PDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLV
AILVEGFQAEEISKREDASGQLSCIQLPVDSQGGDANKSESEPDFFSPSLDGDGDRKKCL
ALVSLGEHPELRKSLLPPLIIHTAATPMSLPKSTSTGLGEALGPASRRTSSSGSAEPGAA
HEMKSPPSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQESQ
DEEESSEEERASPAGSDHRHRGSLEREAKSSFDLPDTLQVPGLHRTASGRGSASEHQDCN
GKSASGRLARALRPDDPPLDGDDADDEGNLSKGERVRAWIRARLPACCLERDSWSAYIFP
PQSRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIFTAV
FLAEMTVKVVALGWCFGEQAYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVL
RLLRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFV
CQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVG
VDQQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRL
RRLEKKRRNLMLDDVIASGSSASAASEAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGV
IGLNVVTMAMEHYQQPQILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDL
AIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQAL
PQVGNLGLLFMLLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVST
GDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKE
AKEEAELEAELELEMKTLSPQPHSPLGSPFLWPGVEGPDSPDSPKPGALHPAAHARSASH
FSLEHPTDRQLFDTISLLIQGSLEWELKLMDELAGPGGQPSAFPSAPSLGGSDPQIPLAE
MEALSLTSEIVSEPSCSLALTDDSLPDDMHTLLLSALESNMQPHPTELPGPDLLTVRKSG
VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTSYILQLPKDAP
HLLQPHSAPTWGTIPKLPPPGRSPLAQRPLRRQAAIRTDSLDVQGLGSREDLLAEVSGPS
PPLARAYSFWGQSSTQAQQHSRSHSKISKHMTPPAPCPGPEPNWGKGPPETRSSLELDTE
LSWISGDLLPPGGQEEPPSPRDLKKCYSVEAQSCQRRPTSWLDEQRRHSIAVSCLDSGSQ
PHLGTDPSNLGGQPLGGPGSRPKKKLSPPSITIDPPESQGPRTPPSPGICLRRRAPSSDS
KDPLASGPPDSMAASPSPKKDVLSLSGLSSDPADLDP
Number of residues2377
Molecular Weight262468.62
Theoretical pI6.57
GO Classification
Functions
  • scaffold protein binding
  • low voltage-gated calcium channel activity
Processes
  • transport
  • synaptic transmission
  • axon guidance
  • membrane depolarization during action potential
  • regulation of atrial cardiac muscle cell membrane depolarization
  • regulation of heart rate
  • regulation of membrane potential
  • calcium ion import
  • response to nickel cation
  • positive regulation of calcium ion-dependent exocytosis
Components
  • voltage-gated calcium channel complex
  • plasma membrane
General FunctionScaffold protein binding
Specific FunctionVoltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1G gives rise to T-type calcium currents. T-type calcium channels belong to the "low-voltage activated (LVA)" group and are strongly blocked by mibefradil. A particularity of this type of channel is an opening at quite negative potentials and a voltage-dependent inactivation. T-type channels serve pacemaking functions in both central neurons and cardiac nodal cells and support calcium signaling in secretory cells and vascular smooth muscle. They may also be involved in the modulation of firing patterns of neurons which is important for information processing as well as in cell growth processes.
Pfam Domain Function
Transmembrane Regions81-101 120-141 151-170 176-193 214-234 371-395 744-764 778-799 806-824 833-856 868-888 940-964 1273-1295 1314-1334 1345-1364 1379-1400 1411-1434 1512-1537 1611-1631 1646-1667 1675-1693 1708-1731 1746-1766 1827-1854
GenBank Protein ID6625659
UniProtKB IDO43497
UniProtKB Entry NameCAC1G_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0021643|Voltage-dependent T-type calcium channel subunit alpha-1G (CACNA1G)
ATGGACGAGGAGGAGGATGGAGCGGGCGCCGAGGAGTCGGGACAGCCCCGGAGCTTCATG
CGGCTCAACGACCTGTCGGGGGCCGGGGGCCGGCCGGGGCCGGGGTCAGCAGAAAAGGAC
CCGGGCAGCGCGGACTCCGAGGCGGAGGGGCTGCCGTACCCGGCGCTGGCCCCGGTGGTT
TTCTTCTACTTGAGCCAGGACAGCCGCCCGCGGAGCTGGTGTCTCCGCACGGTCTGTAAC
CCCTGGTTTGAGCGCATCAGCATGTTGGTCATCCTTCTCAACTGCGTGACCCTGGGCATG
TTCCGGCCATGCGAGGACATCGCCTGTGACTCCCAGCGCTGCCGGATCCTGCAGGCCTTT
GATGACTTCATCTTTGCCTTCTTTGCCGTGGAGATGGTGGTGAAGATGGTGGCCTTGGGC
ATCTTTGGGAAAAAGTGTTACCTGGGAGACACTTGGAACCGGCTTGACTTTTTCATCGTC
ATCGCAGGGATGCTGGAGTACTCGCTGGACCTGCAGAACGTCAGCTTCTCAGCTGTCAGG
ACAGTCCGTGTGCTGCGACCGCTCAGGGCCATTAACCGGGTGCCCAGCATGCGCATCCTT
GTCACGTTGCTGCTGGATACGCTGCCCATGCTGGGCAACGTCCTGCTGCTCTGCTTCTTC
GTCTTCTTCATCTTCGGCATCGTCGGCGTCCAGCTGTGGGCAGGGCTGCTTCGGAACCGA
TGCTTCCTACCTGAGAATTTCAGCCTCCCCCTGAGCGTGGACCTGGAGCGCTATTACCAG
ACAGAGAACGAGGATGAGAGCCCCTTCATCTGCTCCCAGCCACGCGAGAACGGCATGCGG
TCCTGCAGAAGCGTGCCCACGCTGCGCGGGGACGGGGGCGGTGGCCCACCTTGCGGTCTG
GACTATGAGGCCTACAACAGCTCCAGCAACACCACCTGTGTCAACTGGAACCAGTACTAC
ACCAACTGCTCAGCGGGGGAGCACAACCCCTTCAAGGGCGCCATCAACTTTGACAACATT
GGCTATGCCTGGATCGCCATCTTCCAGGTCATCACGCTGGAGGGCTGGGTCGACATCATG
TACTTTGTGATGGATGCTCATTCCTTCTACAATTTCATCTACTTCATCCTCCTCATCATC
GTGGGCTCCTTCTTCATGATCAACCTGTGCCTGGTGGTGATTGCCACGCAGTTCTCAGAG
ACCAAGCAGCGGGAAAGCCAGCTGATGCGGGAGCAGCGTGTGCGGTTCCTGTCCAACGCC
AGCACCCTGGCTAGCTTCTCTGAGCCCGGCAGCTGCTATGAGGAGCTGCTCAAGTACCTG
GTGTACATCCTTCGTAAGGCAGCCCGCAGGCTGGCTCAGGTCTCTCGGGCAGCAGGTGTG
CGGGTTGGGCTGCTCAGCAGCCCAGCACCCCTCGGGGGCCAGGAGACCCAGCCCAGCAGC
AGCTGCTCTCGCTCCCACCGCCGCCTATCCGTCCACCACCTGGTGCACCACCACCACCAC
CATCACCACCACTACCACCTGGGCAATGGGACGCTCAGGGCCCCCCGGGCCAGCCCGGAG
ATCCAGGACAGGGATGCCAATGGGTCCCGCCGGCTCATGCTGCCACCACCCTCGACGCCT
GCCCTCTCCGGGGCCCCCCCTGGTGGCGCAGAGTCTGTGCACAGCTTCTACCATGCCGAC
TGCCACTTAGAGCCAGTCCGCTGCCAGGCGCCCCCTCCCAGGTCCCCATCTGAGGCATCC
GGCAGGACTGTGGGCAGCGGGAAGGTGTATCCCACCGTGCACACCAGCCCTCCACCGGAG
ACGCTGAAGGAGAAGGCACTAGTAGAGGTGGCTGCCAGCTCTGGGCCCCCAACCCTCACC
AGCCTCAACATCCCACCCGGGCCCTACAGCTCCATGCACAAGCTGCTGGAGACACAGAGT
ACAGGTGCCTGCCAAAGCTCTTGCAAGATCTCCAGCCCTTGCTTGAAAGCAGACAGTGGA
GCCTGTGGTCCAGACAGCTGCCCCTACTGTGCCCGGGCCGGGGCAGGGGAGGTGGAGCTC
GCCGACCGTGAAATGCCTGACTCAGACAGCGAGGCAGTTTATGAGTTCACACAGGATGCC
CAGCACAGCGACCTCCGGGACCCCCACAGCCGGCGGCAACGGAGCCTGGGCCCAGATGCA
GAGCCCAGCTCTGTGCTGGCCTTCTGGAGGCTAATCTGTGACACCTTCCGAAAGATTGTG
GACAGCAAGTACTTTGGCCGGGGAATCATGATCGCCATCCTGGTCAACACACTCAGCATG
GGCATCGAATACCACGAGCAGCCCGAGGAGCTTACCAACGCCCTAGAAATCAGCAACATC
GTCTTCACCAGCCTCTTTGCCCTGGAGATGCTGCTGAAGCTGCTTGTGTATGGTCCCTTT
GGCTACATCAAGAATCCCTACAACATCTTCGATGGTGTCATTGTGGTCATCAGCGTGTGG
GAGATCGTGGGCCAGCAGGGGGGCGGCCTGTCGGTGCTGCGGACCTTCCGCCTGATGCGT
GTGCTGAAGCTGGTGCGCTTCCTGCCGGCGCTGCAGCGGCAGCTGGTGGTGCTCATGAAG
ACCATGGACAACGTGGCCACCTTCTGCATGCTGCTTATGCTCTTCATCTTCATCTTCAGC
ATCCTGGGCATGCATCTCTTCGGCTGCAAGTTTGCCTCTGAGCGGGATGGGGACACCCTG
CCAGACCGGAAGAATTTTGACTCCTTGCTCTGGGCCATCGTCACTGTCTTTCAGATCCTG
ACCCAGGAGGACTGGAACAAAGTCCTCTACAATGGTATGGCCTCCACGTCGTCCTGGGCG
GCCCTTTATTTCATTGCCCTCATGACCTTCGGCAACTACGTGCTCTTCAATTTGCTGGTC
GCCATTCTGGTGGAGGGCTTCCAGGCGGAGGAAATCAGCAAACGGGAAGATGCGAGTGGA
CAGTTAAGCTGTATTCAGCTGCCTGTCGACTCCCAGGGGGGAGATGCCAACAAGTCCGAA
TCAGAGCCCGATTTCTTCTCACCCAGCCTGGATGGTGATGGGGACAGGAAGAAGTGCTTG
GCCTTGGTGTCCCTGGGAGAGCACCCGGAGCTGCGGAAGAGCCTGCTGCCGCCTCTCATC
ATCCACACGGCCGCCACACCCATGTCGCTGCCCAAGAGCACCAGCACGGGCCTGGGCGAG
GCGCTGGGCCCTGCGTCGCGCCGCACCAGCAGCAGCGGGTCGGCAGAGCCTGGGGCGGCC
CACGAGATGAAGTCACCGCCCAGCGCCCGCAGCTCTCCGCACAGCCCCTGGAGCGCTGCA
AGCAGCTGGACCAGCAGGCGCTCCAGCCGGAACAGCCTCGGCCGTGCACCCAGCCTGAAG
CGGAGAAGCCCAAGTGGAGAGCGGCGGTCCCTGTTGTCGGGAGAAGGCCAGGAGAGCCAG
GATGAAGAGGAGAGCTCAGAAGAGGAGCGGGCCAGCCCTGCGGGCAGTGACCATCGCCAC
AGGGGGTCCCTGGAGCGGGAGGCCAAGAGTTCCTTTGACCTGCCAGACACACTGCAGGTG
CCAGGGCTGCATCGCACTGCCAGTGGCCGAGGGTCTGCTTCTGAGCACCAGGACTGCAAT
GGCAAGTCGGCTTCAGGGCGCCTGGCCCGGGCCCTGCGGCCTGATGACCCCCCACTGGAT
GGGGATGACGCCGATGACGAGGGCAACCTGAGCAAAGGGGAACGGGTCCGCGCGTGGATC
CGAGCCCGACTCCCTGCCTGCTGCCTCGAGCGAGACTCCTGGTCAGCCTACATCTTCCCT
CCTCAGTCCAGGTTCCGCCTCCTGTGTCACCGGATCATCACCCACAAGATGTTCGACCAC
GTGGTCCTTGTCATCATCTTCCTTAACTGCATCACCATCGCCATGGAGCGCCCCAAAATT
GACCCCCACAGCGCTGAACGCATCTTCCTGACCCTCTCCAATTACATCTTCACCGCAGTC
TTTCTGGCTGAAATGACAGTGAAGGTGGTGGCACTGGGCTGGTGCTTCGGGGAGCAGGCG
TACCTGCGGAGCAGTTGGAACGTGCTGGACGGGCTGTTGGTGCTCATCTCCGTCATCGAC
ATTCTGGTGTCCATGGTCTCTGACAGCGGCACCAAGATCCTGGGCATGCTGAGGGTGCTG
CGGCTGCTGCGGACCCTGCGCCCGCTCAGGGTGATCAGCCGGGCGCAGGGGCTGAAGCTG
GTGGTGGAGACGCTGATGTCCTCACTGAAACCCATCGGCAACATTGTAGTCATCTGCTGT
GCCTTCTTCATCATTTTCGGCATCTTGGGGGTGCAGCTCTTCAAAGGGAAGTTTTTCGTG
TGCCAGGGCGAGGATACCAGGAACATCACCAATAAATCGGACTGTGCCGAGGCCAGTTAC
CGGTGGGTCCGGCACAAGTACAACTTTGACAACCTTGGCCAGGCCCTGATGTCCCTGTTC
GTTTTGGCCTCCAAGGATGGTTGGGTGGACATCATGTACGATGGGCTGGATGCTGTGGGC
GTGGACCAGCAGCCCATCATGAACCACAACCCCTGGATGCTGCTGTACTTCATCTCGTTC
CTGCTCATTGTGGCCTTCTTTGTCCTGAACATGTTTGTGGGTGTGGTGGTGGAGAACTTC
CACAAGTGTCGGCAGCACCAGGAGGAAGAGGAGGCCCGGCGGCGGGAGGAGAAGCGCCTA
CGAAGACTGGAGAAAAAGAGAAGGAAAGCCCAGTGCAAACCTTACTACTCCGACTACTCC
CGCTTCCGGCTCCTCGTCCACCACTTGTGCACCAGCCACTACCTGGACCTCTTCATCACA
GGTGTCATCGGGCTGAACGTGGTCACCATGGCCATGGAGCACTACCAGCAGCCCCAGATT
CTGGATGAGGCTCTGAAGATCTGCAACTACATCTTCACTGTCATCTTTGTCTTGGAGTCA
GTTTTCAAACTTGTGGCCTTTGGTTTCCGTCGGTTCTTCCAGGACAGGTGGAACCAGCTG
GACCTGGCCATTGTGCTGCTGTCCATCATGGGCATCACGCTGGAGGAAATCGAGGTCAAC
GCCTCGCTGCCCATCAACCCCACCATCATCCGCATCATGAGGGTGCTGCGCATTGCCCGA
GTGCTGAAGCTGCTGAAGATGGCTGTGGGCATGCGGGCGCTGCTGGACACGGTGATGCAG
GCCCTGCCCCAGGTGGGGAACCTGGGACTTCTCTTCATGTTGTTGTTTTTCATCTTTGCA
GCTCTGGGCGTGGAGCTCTTTGGAGACCTGGAGTGTGACGAGACACACCCCTGTGAGGGC
CTGGGCCGTCATGCCACCTTTCGGAACTTTGGCATGGCCTTCCTAACCCTCTTCCGAGTC
TCCACAGGTGACAATTGGAATGGCATTATGAAGGACACCCTCCGGGACTGTGACCAGGAG
TCCACCTGCTACAACACGGTCATCTCGCCTATCTACTTTGTGTCCTTCGTGCTGACGGCC
CAGTTCGTGCTAGTCAACGTGGTGATCGCCGTGCTGATGAAGCACCTGGAGGAGAGCAAC
AAGGAGGCCAAGGAGGAGGCCGAGCTAGAGGCTGAGCTGGAGCTGGAGATGAAGACCCTC
AGCCCCCAGCCCCACTCGCCACTGGGCAGCCCCTTCCTCTGGCCTGGGGTCGAGGGCCCC
GACAGCCCCGACAGCCCCAAGCCTGGGGCTCTGCACCCAGCGGCCCACGCGAGATCAGCC
TCCCACTTTTCCCTGGAGCACCCCACGGACAGGCAGCTGTTTGACACCATATCCCTGCTG
ATCCAGGGCTCCCTGGAGTGGGAGCTGAAGCTGATGGACGAGCTGGCAGGCCCAGGGGGC
CAGCCCTCTGCCTTCCCTTCTGCCCCCAGCCTGGGAGGCTCCGACCCACAGATGCAGCCC
CACCCCACGGAGCTGCCAGGACCAGACTTACTGACTGTGCGGAAGTCTGGGGTCAGCCGA
ACGCACTCTCTGCCCAATGACAGCTACATGTGTCGGCATGGGAGCACTGCCGAGGGGCCC
CTGGGACACAGGGGCTGGGGGCTCCCCAAAGCTCAGTCAGGCTCCGTCTTGTCCGTTCAC
TCCCAGCCAGCAGATACCAGCTACATCCTGCAGCTTCCCAAAGATGCACCTCATCTGCTC
CAGCCCCACAGCGCCCCAACCTGGGGCACCATCCCCAAACTGCCCCCACCAGGACGCTCC
CCTTTGGCTCAGAGGCCACTCAGGCGCCAGGCAGCAATAAGGACTGACTCCTTGGACGTT
CAGGGTCTGGGCAGCCGGGAAGACCTGCTGGCAGAGGTGAGTGGGCCCTCCCCGCCCCTG
GCCCGGGCCTACTCTTTCTGGGGCCAGTCAAGTACCCAGGCACAGCAGCACTCCCGCAGC
CACAGCAAGATCTCCAAGCACATGACCCCGCCAGCCCCTTGCCCAGGCCCAGAACCCAAC
TGGGGCAAGGGCCCTCCAGAGACCAGAAGCAGCTTAGAGTTGGACACGGAGCTGAGCTGG
ATTTCAGGAGACCTCCTGCCCCCTGGCGGCCAGGAGGAGCCCCCATCCCCACGGGACCTG
AAGAAGTGCTACAGCGTGGAGGCCCAGAGCTGCCAGCGCCGGCCTACGTCCTGGCTGGAT
GAGCAGAGGAGACACTCTATCGCCGTCAGCTGCCTGGACAGCGGCTCCCAACCCCACCTG
GGCACAGACCCCTCTAACCTTGGGGGCCAGCCTCTTGGGGGGCCTGGGAGCCGGCCCAAG
AAAAAACTCAGCCCGCCTAGTATCACCATAGACCCCCCCGAGAGCCAAGGTCCTCGGACC
CCGCCCAGCCCTGGTATCTGCCTCCGGAGGAGGGCTCCGTCCAGCGACTCCAAGGATCCC
TTGGCCTCTGGCCCCCCTGACAGCATGGCTGCCTCGCCCTCCCCAAAGAAAGATGTGCTG
AGTCTCTCCGGTTTATCCTCTGACCCAGCAGACCTGGACCCCTGA
GenBank Gene IDAF134986
GeneCard IDNot Available
GenAtlas IDCACNA1G
HGNC IDHGNC:1394
Chromosome Location17
Locus17q22
References
  1. Toyota M, Ho C, Ohe-Toyota M, Baylin SB, Issa JP: Inactivation of CACNA1G, a T-type calcium channel gene, by aberrant methylation of its 5' CpG island in human tumors. Cancer Res. 1999 Sep 15;59(18):4535-41. 10493502
  2. Mittman S, Guo J, Agnew WS: Structure and alternative splicing of the gene encoding alpha1G, a human brain T calcium channel alpha1 subunit. Neurosci Lett. 1999 Oct 29;274(3):143-6. 10548410
  3. Cribbs LL, Gomora JC, Daud AN, Lee JH, Perez-Reyes E: Molecular cloning and functional expression of Ca(v)3.1c, a T-type calcium channel from human brain. FEBS Lett. 2000 Jan 21;466(1):54-8. 10648811
  4. Monteil A, Chemin J, Bourinet E, Mennessier G, Lory P, Nargeot J: Molecular and functional properties of the human alpha(1G) subunit that forms T-type calcium channels. J Biol Chem. 2000 Mar 3;275(9):6090-100. 10692398
  5. Emerick MC, Stein R, Kunze R, McNulty MM, Regan MR, Hanck DA, Agnew WS: Profiling the array of Ca(v)3.1 variants from the human T-type calcium channel gene CACNA1G: alternative structures, developmental expression, and biophysical variations. Proteins. 2006 Aug 1;64(2):320-42. 16671074
  6. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. 16625196
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  8. Hirosawa M, Nagase T, Ishikawa K, Kikuno R, Nomura N, Ohara O: Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain. DNA Res. 1999 Oct 29;6(5):329-36. 10574461
  9. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. 12168954
  10. Perez-Reyes E, Cribbs LL, Daud A, Lacerda AE, Barclay J, Williamson MP, Fox M, Rees M, Lee JH: Molecular characterization of a neuronal low-voltage-activated T-type calcium channel. Nature. 1998 Feb 26;391(6670):896-900. 9495342