You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NametRNA wybutosine-synthesizing protein 4
Synonyms
  • 2.1.1.290
  • KIAA0547
  • Leucine carboxyl methyltransferase 2
  • tRNA yW-synthesizing protein 4
  • tRNA(Phe) (7-(3-amino-3-(methoxycarbonyl)propyl)wyosine(37)-N)-methoxycarbonyltransferase
  • tRNA(Phe) (7-(3-amino-3-carboxypropyl)wyosine(37)-O)-methyltransferase
  • TYW4
Gene NameLCMT2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0001223|tRNA wybutosine-synthesizing protein 4
MGPRSRERRAGAVQNTNDSSALSKRSLAARGYVQDPFAALLVPGAARRAPLIHRGYYVRA
RAVRHCVRAFLEQIGAPQAALRAQILSLGAGFDSLYFRLKTAGRLARAAVWEVDFPDVAR
RKAERIGETPELCALTGPFERGEPASALCFESADYCILGLDLRQLQRVEEALGAAGLDAA
SPTLLLAEAVLTYLEPESAAALIAWAAQRFPNALFVVYEQMRPQDAFGQFMLQHFRQLNS
PLHGLERFPDVEAQRRRFLQAGWTACGAVDMNEFYHCFLPAEERRRVENIEPFDEFEEWH
LKCAHYFILAASRGDTLSHTLVFPSSEAFPRVNPASPSGVFPASVVSSEGQVPNLKRYGH
ASVFLSPDVILSAGGFGEQEGRHCRVSQFHLLSRDCDSEWKGSQIGSCGTGVQWDGRLYH
TMTRLSESRVLVLGGRLSPVSPALGVLQLHFFKSEDNNTEDLKVTITKAGRKDDSTLCCW
RHSTTEVSCQNQEYLFVYGGRSVVEPVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSAC
TWQGGALIAGGLGASEEPLNSVLFLRPISCGFLWESVDIQPPITPRYSHTAHVLNGKLLL
VGGIWIHSSSFPGVTVINLTTGLSSEYQIDTTYVPWPLMLHNHTSILLPEEQQLLLLGGG
GNCFSFGTYFNPHTVTLDLSSLSAGQ
Number of residues686
Molecular Weight75601.095
Theoretical pI6.71
GO Classification
Functions
  • S-adenosylmethionine-dependent methyltransferase activity
  • tRNA methyltransferase activity
Processes
  • tRNA modification
  • tRNA processing
  • gene expression
  • tRNA methylation
  • wybutosine biosynthetic process
Components
  • cytoplasm
  • cytosol
General FunctionTrna methyltransferase activity
Specific FunctionProbable S-adenosyl-L-methionine-dependent methyltransferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA (By similarity). May methylate the carboxyl group of leucine residues to form alpha-leucine ester residues.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID40788285
UniProtKB IDO60294
UniProtKB Entry NameTYW4_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0010426|tRNA wybutosine-synthesizing protein 4 (LCMT2)
ATGGGCCCCCGGAGCCGTGAGCGTCGGGCAGGCGCGGTACAGAACACCAACGACAGCAGC
GCCCTCAGCAAGCGTTCCCTGGCCGCGCGCGGGTACGTGCAGGACCCCTTTGCCGCGTTG
CTGGTTCCGGGCGCGGCGCGCCGCGCACCGCTCATTCACCGAGGCTACTACGTCCGCGCA
CGCGCCGTGAGGCACTGCGTGCGCGCTTTTTTGGAGCAGATTGGCGCGCCCCAGGCCGCG
CTTCGCGCGCAGATCTTGTCTCTCGGCGCTGGCTTCGACTCGCTCTATTTTCGCTTAAAA
ACCGCGGGCCGCCTGGCCCGGGCTGCAGTCTGGGAGGTGGATTTTCCGGACGTGGCGCGG
CGCAAAGCAGAAAGGATTGGAGAGACGCCAGAGCTGTGCGCGTTAACCGGGCCTTTCGAG
AGGGGGGAGCCCGCGTCCGCGCTGTGCTTTGAGAGCGCAGACTACTGCATCCTGGGTCTG
GACTTGCGGCAGCTCCAGCGAGTGGAGGAGGCCCTGGGCGCCGCGGGGCTCGACGCAGCC
TCACCCACTCTGCTCCTGGCCGAGGCGGTGCTGACCTACCTCGAGCCGGAGAGTGCCGCG
GCCCTCATCGCCTGGGCAGCCCAGCGTTTTCCTAATGCCCTTTTCGTGGTCTATGAGCAG
ATGAGGCCTCAAGACGCCTTTGGCCAGTTCATGCTGCAACATTTTCGGCAGCTAAACTCC
CCCCTGCATGGCCTGGAGCGTTTTCCTGACGTGGAGGCGCAGCGGCGCCGCTTCCTTCAA
GCTGGCTGGACCGCCTGCGGTGCCGTGGACATGAATGAATTCTATCACTGCTTTCTTCCC
GCAGAAGAACGCCGGCGGGTGGAAAATATTGAACCCTTTGACGAATTTGAGGAGTGGCAT
CTGAAGTGCGCCCATTATTTCATTCTGGCAGCTTCTAGGGGAGACACCCTCTCCCACACC
CTAGTGTTTCCATCCTCAGAGGCATTTCCTCGCGTAAATCCTGCTTCGCCTTCAGGGGTA
TTCCCTGCCAGCGTAGTCAGTAGCGAGGGCCAGGTCCCAAACCTGAAGAGATATGGCCAC
GCCTCTGTCTTCTTGAGCCCAGACGTTATTCTCAGTGCAGGAGGATTTGGAGAGCAGGAG
GGGCGGCACTGCCGAGTGAGCCAGTTTCACTTGCTCTCAAGAGATTGTGACTCTGAATGG
AAAGGCAGCCAAATAGGCAGTTGTGGGACTGGAGTTCAGTGGGATGGACGCCTTTATCAC
ACCATGACAAGACTCTCAGAGAGTCGGGTTCTGGTTCTGGGAGGGAGACTGTCCCCAGTA
AGTCCAGCCTTGGGGGTTCTCCAGCTTCATTTTTTTAAGAGTGAGGATAATAACACTGAG
GACCTGAAAGTGACAATAACAAAGGCTGGCCGAAAGGATGATTCCACTTTGTGTTGTTGG
CGGCATTCAACAACAGAAGTGTCCTGTCAGAATCAGGAATATTTGTTTGTGTATGGGGGT
CGAAGCGTGGTGGAACCTGTACTAAGTGACTGGCATTTCCTCCATGTAGGGACAATGGCT
TGGGTCAGGATCCCAGTGGAGGGAGAAGTACCTGAAGCCCGGCATTCTCACAGTGCCTGC
ACTTGGCAAGGGGGAGCCCTTATTGCTGGAGGTCTCGGGGCTTCTGAGGAGCCATTGAAC
TCTGTGCTCTTTCTGAGACCAATCTCTTGTGGATTCCTCTGGGAGTCAGTAGACATCCAG
CCTCCCATTACCCCAAGGTACTCCCACACAGCTCATGTGCTCAATGGAAAGCTGTTACTG
GTTGGAGGGATCTGGATTCATTCCTCCTCATTTCCTGGAGTGACTGTGATCAATTTGACT
ACAGGATTGAGCTCTGAGTATCAGATTGACACAACATATGTGCCATGGCCATTAATGTTA
CACAACCATACTAGTATCCTTCTTCCTGAAGAGCAACAGCTCCTGCTCCTTGGAGGTGGT
GGGAACTGCTTTTCCTTTGGTACCTACTTCAACCCCCATACAGTCACATTAGACCTTTCT
TCCTTAAGTGCTGGGCAGTAA
GenBank Gene IDAB011119
GeneCard IDNot Available
GenAtlas IDLCMT2
HGNC IDHGNC:17558
Chromosome Location15
Locus15q15.3
References
  1. Nagase T, Ishikawa K, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Feb 28;5(1):31-9. 9628581
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Ng CC, Arakawa H, Fukuda S, Kondoh H, Nakamura Y: p53RFP, a p53-inducible RING-finger protein, regulates the stability of p21WAF1. Oncogene. 2003 Jul 10;22(28):4449-58. 12853982