You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameVoltage-dependent calcium channel gamma-3 subunit
Synonyms
  • Neuronal voltage-gated calcium channel gamma-3 subunit
  • TARP gamma-3
  • Transmembrane AMPAR regulatory protein gamma-3
Gene NameCACNG3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013464|Voltage-dependent calcium channel gamma-3 subunit
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH
SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL
CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRST
EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK
ESLHNNPANRRTTPV
Number of residues315
Molecular Weight35548.14
Theoretical pINot Available
GO Classification
Functions
  • channel regulator activity
  • voltage-gated calcium channel activity
Processes
  • regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity
  • calcium ion transport
  • transmission of nerve impulse
  • synaptic transmission
  • calcium ion transmembrane transport
Components
  • endocytic vesicle membrane
  • AMPA glutamate receptor complex
  • voltage-gated calcium channel complex
  • plasma membrane
General FunctionVoltage-gated calcium channel activity
Specific FunctionRegulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. Thought to stabilize the calcium channel in an inactivated (closed) state (By similarity).
Pfam Domain Function
Transmembrane Regions8-28 104-124 135-155 181-201
GenBank Protein IDNot Available
UniProtKB IDO60359
UniProtKB Entry NameCCG3_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0013465|Voltage-dependent calcium channel gamma-3 subunit (CACNG3)
ATGAGGATGTGTGACAGAGGTATCCAGATGTTGATCACCACTGTAGGAGCCTTTGCCGCT
TTTAGTTTAATGACCATTGCAGTGGGCACGGACTACTGGTTATATTCCAGAGGTGTGTGC
AGGACTAAATCTACAAGTGATAATGAAACCAGCAGGAAGAATGAAGAAGTAATGACCCAT
TCGGGGCTGTGGAGGACCTGCTGCCTAGAAGGGGCTTTCCGAGGCGTGTGCAAGAAAATC
GATCACTTCCCTGAAGATGCTGACTACGAACAGGACACAGCCGAATATCTCCTGCGAGCT
GTGAGGGCCTCCAGTGTCTTCCCCATCCTCAGTGTCACGCTGCTGTTCTTCGGCGGGCTC
TGCGTGGCAGCCAGTGAGTTCCACCGCAGCAGACACAACGTCATTCTCAGCGCGGGCATC
TTTTTTGTCTCTGCAGGGTTAAGCAACATCATTGGCATCATAGTTTATATATCAGCCAAC
GCCGGAGACCCCGGGCAGCGTGACTCCAAAAAAAGTTACTCCTATGGTTGGTCCTTTTAT
TTCGGAGCCTTCTCTTTCATCATCGCAGAAATTGTAGGAGTGGTTGCCGTGCACATCTAT
ATTGAAAAACATCAGCAGTTACGAGCCAAATCCCACTCGGAGTTCCTGAAGAAATCTACT
TTTGCCCGCCTCCCACCCTACAGGTATCGATTCCGGAGGCGGTCAAGTTCTCGCTCCACC
GAGCCCAGATCCCGAGACCTGTCCCCCATCAGCAAAGGCTTCCACACCATCCCTTCCACT
GACATCTCGATGTTCACCCTCTCCCGGGACCCCTCAAAGATCACCATGGGGACCCTCCTC
AACTCCGACCGGGACCACGCTTTTCTACAGTTCCACAATTCCACACCCAAAGAGTTCAAA
GAGTCACTGCATAATAATCCGGCCAACAGGCGCACCACGCCCGTCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:1407
Chromosome Location16
LocusNot Available
References
  1. Black JL 3rd, Lennon VA: Identification and cloning of putative human neuronal voltage-gated calcium channel gamma-2 and gamma-3 subunits: neurologic implications. Mayo Clin Proc. 1999 Apr;74(4):357-61. 10221464
  2. Loftus BJ, Kim UJ, Sneddon VP, Kalush F, Brandon R, Fuhrmann J, Mason T, Crosby ML, Barnstead M, Cronin L, Deslattes Mays A, Cao Y, Xu RX, Kang HL, Mitchell S, Eichler EE, Harris PC, Venter JC, Adams MD: Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q. Genomics. 1999 Sep 15;60(3):295-308. 10493829
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334