You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGlutamate receptor ionotropic, NMDA 3B
Synonyms
  • GluN3B
  • N-methyl-D-aspartate receptor subtype 3B
  • NMDAR3B
  • NR3B
Gene NameGRIN3B
OrganismHuman
Amino acid sequence
>lcl|BSEQ0001066|Glutamate receptor ionotropic, NMDA 3B
MEFVRALWLGLALALGPGSAGGHPQPCGVLARLGGSVRLGALLPRAPLARARARAALARA
ALAPRLPHNLSLELVVAAPPARDPASLTRGLCQALVPPGVAALLAFPEARPELLQLHFLA
AATETPVLSLLRREARAPLGAPNPFHLQLHWASPLETLLDVLVAVLQAHAWEDVGLALCR
TQDPGGLVALWTSRAGRPPQLVLDLSRRDTGDAGLRARLAPMAAPVGGEAPVPAAVLLGC
DIARARRVLEAVPPGPHWLLGTPLPPKALPTAGLPPGLLALGEVARPPLEAAIHDIVQLV
ARALGSAAQVQPKRALLPAPVNCGDLQPAGPESPGRFLARFLANTSFQGRTGPVWVTGSS
QVHMSRHFKVWSLRRDPRGAPAWATVGSWRDGQLDLEPGGASARPPPPQGAQVWPKLRVV
TLLEHPFVFARDPDEDGQCPAGQLCLDPGTNDSATLDALFAALANGSAPRALRKCCYGYC
IDLLERLAEDTPFDFELYLVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQ
VVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLGVFAALHLTALFLTVYEWRSP
YGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSY
TANLAAVMVGDKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRH
SAPTTPRGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQN
SPLTSNLSEFISRYKSSGFIDLLHDKWYKMVPCGKRVFAVTETLQMSIYHFAGLFVLLCL
GLGSALLSSLGEHAFFRLALPRIRKGSRLQYWLHTSQKIHRALNTEPPEGSKEETAEAEP
SGPEVEQQQQQQDQPTAPEGWKRARRAVDKERRVRFLLEPAVVVAPEADAEAEAAPREGP
VWLCSYGRPPAARPTGAPQPGELQELERRIEVARERLRQALVRRGQLLAQLGDSARHRPR
RLLQARAAPAEAPPHSGRPGSQE
Number of residues1043
Molecular Weight112990.98
Theoretical pI9.5
GO Classification
Functions
  • glycine binding
  • extracellular-glutamate-gated ion channel activity
  • NMDA glutamate receptor activity
  • neurotransmitter binding
  • cation channel activity
  • neurotransmitter receptor activity
  • calcium channel activity
Processes
  • regulation of calcium ion transport
  • synaptic transmission, glutamatergic
  • ionotropic glutamate receptor signaling pathway
  • protein insertion into membrane
  • ion transmembrane transport
Components
  • neuronal cell body
  • NMDA selective glutamate receptor complex
  • postsynaptic membrane
  • plasma membrane
  • cell junction
  • dendrite
General FunctionNmda glutamate receptor activity
Specific FunctionNMDA receptor subtype of glutamate-gated ion channels with reduced single-channel conductance, low calcium permeability and low voltage-dependent sensitivity to magnesium. Mediated by glycine.
Pfam Domain Function
Transmembrane Regions565-585 649-669 831-851
GenBank Protein ID3025446
UniProtKB IDO60391
UniProtKB Entry NameNMD3B_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0016125|Glutamate receptor ionotropic, NMDA 3B (GRIN3B)
ATGGAGTTTGTGCGGGCGCTGTGGCTGGGCCTGGCGCTGGCGCTGGGGCCGGGGTCCGCG
GGGGGCCACCCTCAGCCGTGCGGCGTCCTGGCGCGCCTCGGGGGCTCCGTGCGCCTGGGC
GCCCTCCTGCCCCGCGCGCCTCTCGCCCGCGCCCGCGCCCGCGCCGCCCTGGCCCGGGCC
GCCCTGGCGCCGCGGCTGCCGCACAACCTGAGCTTGGAGCTGGTGGTCGCCGCGCCCCCC
GCCCGCGACCCCGCCTCGCTGACCCGCGGCCTGTGCCAGGCGCTGGTGCCTCCGGGCGTG
GCGGCCCTGCTCGCCTTTCCCGAGGCTCGGCCCGAGCTGCTGCAGCTGCACTTCCTGGCG
GCGGCCACCGAGACCCCCGTGCTCAGCCTGCTGCGGCGGGAGGCGCGCGCGCCCCTCGGA
GCCCCGAACCCATTCCACCTGCAGCTGCACTGGGCCAGCCCCCTGGAGACGCTGCTGGAT
GTGCTGGTGGCGGTGCTGCAGGCGCACGCCTGGGAAGACGTCGGCCTGGCCCTGTGCCGC
ACTCAGGACCCCGGCGGCCTGGTGGCCCTCTGGACAAGCCGGGCTGGCCGGCCCCCACAG
CTGGTCCTGGACCTAAGCCGGCGGGACACGGGAGATGCAGGACTGCGGGCACGCCTGGCC
CCGATGGCGGCGCCAGTGGGGGGTGAAGCACCGGTACCCGCGGCGGTCCTCCTCGGCTGT
GACATCGCCCGTGCCCGTCGGGTGCTGGAGGCCGTACCTCCCGGCCCCCACTGGCTGTTG
GGGACACCACTGCCGCCCAAGGCCCTGCCCACCGCGGGGCTGCCACCAGGGCTGCTGGCG
CTGGGCGAGGTGGCACGACCCCCGCTGGAGGCCGCCATCCATGACATTGTGCAACTGGTG
GCCCGGGCGCTGGGCAGTGCGGCCCAGGTGCAGCCGAAGCGAGCCCTCCTCCCCGCCCCG
GTCAACTGCGGGGACCTGCAGCCGGCCGGGCCCGAGTCCCCGGGGCGCTTCTTGGCACGG
TTCCTGGCCAACACGTCCTTCCAGGGCCGCACGGGCCCCGTGTGGGTGACAGGCAGCTCC
CAGGTACACATGTCTCGGCACTTTAAGGTGTGGAGCCTTCGCCGGGACCCACGGGGCGCC
CCGGCCTGGGCCACGGTGGGCAGCTGGCGGGACGGCCAGCTGGACTTGGAACCGGGAGGT
GCCTCTGCACGGCCCCCGCCCCCACAGGGTGCCCAGGTCTGGCCCAAGCTGCGTGTGGTA
ACGCTGTTGGAACACCCATTTGTGTTTGCCCGTGATCCAGACGAAGACGGGCAGTGCCCA
GCGGGGCAGCTGTGCCTGGACCCTGGCACCAACGACTCGGCCACCCTGGACGCACTGTTC
GCCGCGCTGGCCAACGGCTCAGCGCCCCGTGCCCTGCGCAAGTGCTGCTACGGCTACTGC
ATTGACCTGCTGGAGCGGCTGGCGGAGGACACGCCCTTCGACTTCGAGCTGTACCTCGTG
GGTGACGGCAAGTACGGCGCCCTGCGGGACGGCCGCTGGACCGGCCTGGTCGGGGACCTG
CTGGCCGGCCGGGCCCACATGGCGGTCACCAGCTTCAGTATCAACTCCGCCCGCTCACAG
GTGGTGGACTTCACCAGCCCCTTCTTCTCCACCAGCCTGGGCATCATGGTGCGGGCACGG
GACACGGCCTCACCCATCGGTGCCTTTATGTGGCCCCTGCACTGGTCCACGTGGCTGGGC
GTCTTTGCGGCCCTGCACCTCACCGCGCTCTTCCTCACCGTGTACGAGTGGCGTAGCCCC
TACGGCCTCACGCCACGTGGCCGCAACCGCAGCACCGTCTTCTCCTACTCCTCAGCCCTC
AACCTGTGCTACGCCATCCTCTTCAGACGCACCGTGTCCAGCAAGACGCCCAAGTGCCCC
ACGGGCCGCCTGCTCATGAACCTCTGGGCCATCTTCTGCCTGCTGGTGCTGTCCAGCTAC
ACGGCCAACCTGGCTGCCGTCATGGTCGGGGACAAGACCTTCGAGGAGCTGTCGGGGATC
CACGACCCCAAGCTGCACCACCCGGCGCAGGGCTTCCGCTTCGGCACCGTGTGGGAGAGC
AGCGCCGAGGCGTACATCAAGAAGAGCTTCCCCGACATGCACGCACACATGCGGCGCCAC
AGCGCGCCCACCACGCCCCGCGGCGTCGCCATGCTCACGAGCGACCCCCCCAAGCTCAAC
GCCTTCATCATGGACAAGTCGCTCCTGGACTACGAGGTCTCCATCGACGCCGACTGCAAA
CTGCTGACCGTGGGAAAGCCCTTCGCCATTGAGGGCTATGGGATCGGACTGCCCCAGAAC
TCGCCGCTCACCTCCAACCTGTCCGAGTTCATCAGCCGCTACAAGTCCTCCGGCTTCATC
GACCTGCTCCACGACAAGTGGTACAAGATGGTGCCTTGCGGCAAGCGGGTCTTTGCGGTT
ACAGAGACCCTGCAGATGAGCATCTACCACTTCGCGGGCCTCTTCGTGTTGCTGTGCCTG
GGCCTGGGCAGCGCTCTGCTCAGCTCGCTGGGCGAGCACGCCTTCTTCCGCCTGGCGCTG
CCGCGCATCCGCAAGGGGAGCAGGCTGCAGTACTGGCTGCACACCAGCCAGAAAATCCAC
CGCGCCCTCAACACGGAGCCACCAGAGGGGTCGAAGGAGGAGACGGCAGAGGCGGAGCCC
AGCGGCCCCGAGGTGGAGCAGCAGCAGCAGCAGCAGGACCAGCCAACGGCTCCGGAGGGC
TGGAAACGGGCGCGCCGGGCCGTGGACAAGGAGCGCCGCGTGCGCTTCCTGCTGGAGCCC
GCCGTGGTTGTGGCACCCGAAGCGGACGCGGAGGCGGAGGCTGCGCCGCGAGAGGGCCCC
GTCTGGCTGTGCTCCTACGGCCGCCCGCCCGCCGCAAGGCCCACGGGGGCCCCCCAGCCC
GGGGAGCTGCAGGAGCTGGAGCGCCGCATCGAAGTCGCGCGTGAGCGGCTCCGCCAGGCC
CTGGTGCGGCGCGGCCAGCTCCTGGCACAGCTCGGGGACAGCGCACGTCACCGGCCTCGG
CGCTTGCTTCAGGCCAGAGCGGCCCCCGCGGAGGCCCCACCACACTCTGGCCGACCGGGG
AGCCAGGAATGA
GenBank Gene IDAC004528
GeneCard IDNot Available
GenAtlas IDGRIN3B
HGNC IDHGNC:16768
Chromosome Location19
Locus19p13.3
References
  1. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. 15057824
  2. Andersson O, Stenqvist A, Attersand A, von Euler G: Nucleotide sequence, genomic organization, and chromosomal localization of genes encoding the human NMDA receptor subunits NR3A and NR3B. Genomics. 2001 Dec;78(3):178-84. 11735224
  3. Nishi M, Hinds H, Lu HP, Kawata M, Hayashi Y: Motoneuron-specific expression of NR3B, a novel NMDA-type glutamate receptor subunit that works in a dominant-negative manner. J Neurosci. 2001 Dec 1;21(23):RC185. 11717388
  4. Bendel O, Meijer B, Hurd Y, von Euler G: Cloning and expression of the human NMDA receptor subunit NR3B in the adult human hippocampus. Neurosci Lett. 2005 Mar 22;377(1):31-6. Epub 2004 Dec 15. 15722182