You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameLysine-specific demethylase PHF2
Synonyms
  • 1.14.11.-
  • CENP-35
  • GRC5
  • KIAA0662
  • PHD finger protein 2
Gene NamePHF2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037291|Lysine-specific demethylase PHF2
MATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKS
TLKKKRTWHKHGPGQAPDVKPVQNGSQLFIKELRSRTFPSAEDVVARVPGSQLTLGYMEE
HGFTEPILVPKKDGLGLAVPAPTFYVSDVENYVGPERSVDVTDVTKQKDCKMKLKEFVDY
YYSTNRKRVLNVTNLEFSDTRMSSFVEPPDIVKKLSWVENYWPDDALLAKPKVTKYCLIC
VKDSYTDFHIDSGGASAWYHVLKGEKTFYLIRPASANISLYERWRSASNHSEMFFADQVD
KCYKCIVKQGQTLFIPSGWIYATLTPVDCLAFAGHFLHSLSVEMQMRAYEVERRLKLGSL
TQFPNFETACWYMGKHLLEAFKGSHKSGKQLPPHLVQGAKILNGAFRSWTKKQALAEHED
ELPEHFKPSQLIKDLAKEIRLSENASKAVRPEVNTVASSDEVCDGDREKEEPPSPIEATP
PQSLLEKVSKKKTPKTVKMPKPSKIPKPPKPPKPPRPPKTLKLKDGGKKKGKKSRESASP
TIPNLDLLEAHTKEALTKMEPPKKGKATKSVLSVPNKDVVHMQNDVERLEIREQTKSKSE
AKWKYKNSKPDSLLKMEEEQKLEKSPLAGNKDNKFSFSFSNKKLLGSKALRPPTSPGVFG
ALQNFKEDKPKPVRDEYEYVSDDGELKIDEFPIRRKKNAPKRDLSFLLDKKAVLPTPVTK
PKLDSAAYKSDDSSDEGSLHIDTDTKPGRNARVKKESGSSAAGILDLLQASEEVGALEYN
PSSQPPASPSTQEAIQGMLSMANLQASDSCLQTTWGAGQAKGSSLAAHGARKNGGGSGKS
AGKRLLKRAAKNSVDLDDYEEEQDHLDACFKDSDYVYPSLESDEDNPIFKSRSKKRKGSD
DAPYSPTARVGPSVPRQDRPVREGTRVASIETGLAAAAAKLSQQEEQKSKKKKSAKRKLT
PNTTSPSTSTSISAGTTSTSTTPASTTPASTTPASTSTASSQASQEGSSPEPPPESHSSS
LADHEYTAAGTFTGAQAGRTSQPMAPGVFLTQRRPSASSPNNNTAAKGKRTKKGMATAKQ
RLGKILKIHRNGKLLL
Number of residues1096
Molecular Weight120773.925
Theoretical pINot Available
GO Classification
Functions
  • dioxygenase activity
  • methylated histone binding
  • histone demethylase activity (H3-K9 specific)
  • iron ion binding
  • zinc ion binding
Processes
  • liver development
  • transcription, DNA-templated
  • chromatin organization
  • protein demethylation
  • negative regulation of chromatin silencing at rDNA
Components
  • nucleus
  • nucleolus
  • nucleoplasm
  • condensed chromosome kinetochore
  • cytoplasm
General FunctionZinc ion binding
Specific FunctionLysine demethylase that demethylates both histones and non-histone proteins. Enzymatically inactive by itself, and becomes active following phosphorylation by PKA: forms a complex with ARID5B and mediates demethylation of methylated ARID5B. Demethylation of ARID5B leads to target the PHF2-ARID5B complex to target promoters, where PHF2 mediates demethylation of dimethylated 'Lys-9' of histone H3 (H3K9me2), followed by transcription activation of target genes. The PHF2-ARID5B complex acts as a coactivator of HNF4A in liver. PHF2 is recruited to trimethylated 'Lys-4' of histone H3 (H3K4me3) at rDNA promoters and promotes expression of rDNA.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDO75151
UniProtKB Entry NamePHF2_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0017853|Lysine-specific demethylase PHF2 (PHF2)
ATGGCGACGGTGCCCGTGTACTGCGTCTGCCGGCTCCCCTACGACGTTACCCGCTTCATG
ATCGAGTGCGACGCCTGCAAGGACTGGTTCCACGGCAGCTGTGTTGGGGTGGAAGAGGAG
GAGGCGCCCGACATCGACATATACCACTGCCCAAACTGTGAGAAAACCCATGGGAAGTCC
ACCTTAAAGAAGAAGCGGACCTGGCACAAACACGGCCCGGGGCAAGCGCCTGACGTCAAG
CCCGTGCAGAATGGCAGCCAGCTCTTCATCAAGGAGCTGCGGAGCCGGACCTTTCCCAGT
GCTGAAGACGTGGTGGCCCGTGTGCCAGGAAGTCAGCTCACGCTGGGCTACATGGAGGAG
CACGGCTTCACCGAGCCCATCCTCGTCCCTAAGAAAGACGGGCTGGGTCTGGCTGTCCCG
GCCCCCACGTTCTATGTCAGTGACGTCGAGAACTACGTGGGGCCGGAACGGAGTGTGGAT
GTGACAGATGTCACCAAGCAGAAGGACTGCAAGATGAAGCTGAAGGAGTTTGTGGACTAT
TACTACAGCACCAACCGCAAGCGGGTCCTCAACGTCACCAACCTCGAGTTCTCTGACACC
CGAATGTCCAGCTTCGTGGAGCCACCTGACATTGTAAAGAAACTGTCATGGGTAGAAAAC
TACTGGCCAGATGATGCATTGCTGGCCAAGCCCAAAGTGACCAAGTACTGCCTAATCTGC
GTGAAGGACAGTTACACCGACTTCCACATCGACTCTGGGGGCGCCTCTGCCTGGTACCAC
GTGCTCAAGGGGGAGAAGACCTTCTATCTCATCAGGCCGGCCTCGGCCAACATCTCCCTG
TATGAGCGCTGGCGGTCTGCCTCTAACCACAGCGAGATGTTCTTTGCTGACCAGGTCGAC
AAATGCTACAAGTGCATCGTCAAGCAGGGCCAGACCCTCTTCATCCCCTCAGGCTGGATC
TACGCCACACTCACCCCTGTGGACTGCCTGGCCTTCGCGGGACATTTCCTCCACAGCCTG
AGTGTGGAGATGCAGATGAGAGCATATGAAGTGGAAAGGAGGTTGAAACTGGGCAGCCTG
ACTCAGTTTCCCAACTTTGAAACTGCGTGCTGGTACATGGGGAAGCACCTGCTGGAGGCA
TTCAAAGGCTCTCACAAATCTGGGAAGCAGCTGCCCCCTCATCTAGTCCAAGGAGCTAAA
ATTCTCAATGGTGCTTTCCGATCGTGGACGAAGAAGCAGGCTTTGGCAGAGCATGAGGAC
GAGCTCCCGGAGCACTTCAAACCTTCACAGCTAATCAAAGACCTGGCCAAAGAGATCCGG
CTCAGTGAGAATGCCTCCAAAGCCGTCCGACCGGAAGTGAATACTGTCGCCTCGTCAGAT
GAGGTGTGTGACGGGGACCGGGAGAAGGAGGAGCCCCCGTCTCCCATTGAGGCCACCCCG
CCTCAATCCCTCCTGGAGAAAGTGTCCAAAAAAAAGACTCCCAAAACTGTGAAGATGCCC
AAGCCATCCAAAATCCCCAAGCCCCCGAAGCCCCCTAAGCCCCCAAGGCCCCCCAAAACG
CTGAAGCTCAAAGATGGAGGCAAGAAGAAAGGGAAGAAGTCCCGGGAGTCAGCCTCACCC
ACCATCCCCAACCTGGACCTGCTCGAAGCCCACACCAAGGAGGCACTGACCAAGATGGAG
CCGCCCAAGAAGGGCAAGGCCACAAAGAGTGTCCTGAGTGTGCCCAACAAAGATGTGGTT
CACATGCAGAATGATGTGGAGAGGCTGGAAATTCGAGAGCAAACCAAGAGCAAGTCAGAG
GCCAAGTGGAAGTACAAGAACAGCAAACCTGACTCCTTACTGAAGATGGAAGAGGAGCAG
AAGCTAGAGAAGTCGCCTCTAGCTGGAAACAAAGACAATAAGTTCTCTTTTTCTTTCTCC
AACAAGAAACTCCTCGGCTCCAAGGCTCTCAGGCCCCCGACGAGCCCTGGTGTGTTCGGG
GCCTTGCAGAACTTCAAGGAGGACAAGCCCAAGCCCGTGCGGGATGAGTATGAGTACGTG
TCGGATGACGGTGAGCTCAAGATCGACGAGTTTCCCATCAGGAGGAAGAAAAACGCCCCG
AAAAGGGACTTGTCCTTCTTGTTGGATAAGAAGGCTGTGCTGCCCACGCCTGTCACGAAG
CCAAAGCTGGACTCGGCAGCGTACAAGAGTGATGACTCCTCGGACGAGGGTTCGCTGCAC
ATCGACACAGACACCAAGCCCGGCCGCAATGCCAGAGTCAAGAAGGAGAGTGGGAGCTCG
GCAGCTGGCATCTTGGACCTGCTGCAGGCCAGTGAGGAGGTTGGCGCGCTGGAGTACAAC
CCCAGCAGCCAGCCCCCGGCCTCCCCCAGCACACAGGAAGCCATTCAGGGAATGCTGTCC
ATGGCCAACCTGCAGGCCTCCGACTCCTGCCTGCAGACCACGTGGGGAGCTGGCCAGGCC
AAGGGGAGCTCGCTGGCTGCCCATGGTGCCCGGAAGAATGGGGGTGGCAGTGGCAAGAGT
GCAGGCAAACGACTGCTGAAGAGGGCTGCCAAGAACAGTGTCGACCTGGACGACTACGAG
GAAGAGCAGGACCACCTGGATGCCTGCTTCAAGGACTCAGACTACGTTTACCCCTCACTG
GAGTCAGATGAAGACAACCCCATCTTTAAGTCCCGGTCGAAGAAAAGGAAAGGCTCAGAC
GACGCTCCCTACAGCCCAACAGCAAGGGTCGGCCCATCGGTGCCAAGACAGGACAGGCCT
GTGCGTGAGGGTACACGGGTGGCTTCCATCGAGACCGGGCTGGCGGCTGCTGCAGCTAAG
TTGTCCCAGCAGGAGGAGCAGAAAAGCAAGAAAAAAAAGAGTGCCAAGAGGAAGCTGACT
CCTAACACCACCTCCCCTTCCACCTCCACCTCCATCTCTGCCGGCACCACCTCCACCTCC
ACCACGCCAGCCTCTACCACCCCGGCCTCCACCACCCCGGCCTCCACCAGCACGGCCAGC
AGCCAGGCCTCGCAGGAGGGCAGCTCGCCAGAGCCCCCGCCTGAGTCGCATAGCAGCAGC
CTGGCGGACCATGAGTACACAGCCGCTGGCACCTTCACCGGGGCCCAGGCTGGCCGCACC
TCCCAGCCCATGGCCCCTGGGGTCTTTCTCACACAGAGGCGGCCCTCCGCATCGTCTCCA
AACAACAACACCGCTGCCAAAGGAAAACGTACGAAAAAGGGCATGGCGACCGCCAAGCAG
AGGCTTGGGAAAATTTTGAAAATTCATCGGAACGGGAAACTACTCCTTTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:8920
Chromosome Location9
LocusNot Available
References
  1. Hasenpusch-Theil K, Chadwick BP, Theil T, Heath SK, Wilkinson DG, Frischauf AM: PHF2, a novel PHD finger gene located on human chromosome 9q22. Mamm Genome. 1999 Mar;10(3):294-8. 10051327
  2. Ishikawa K, Nagase T, Suyama M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Jun 30;5(3):169-76. 9734811
  3. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. 12168954
  4. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. 15164053
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. 17081983
  7. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  9. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  10. Ohta S, Bukowski-Wills JC, Sanchez-Pulido L, Alves Fde L, Wood L, Chen ZA, Platani M, Fischer L, Hudson DF, Ponting CP, Fukagawa T, Earnshaw WC, Rappsilber J: The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics. Cell. 2010 Sep 3;142(5):810-21. doi: 10.1016/j.cell.2010.07.047. 20813266
  11. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  12. Baba A, Ohtake F, Okuno Y, Yokota K, Okada M, Imai Y, Ni M, Meyer CA, Igarashi K, Kanno J, Brown M, Kato S: PKA-dependent regulation of the histone lysine demethylase complex PHF2-ARID5B. Nat Cell Biol. 2011 Jun;13(6):668-75. doi: 10.1038/ncb2228. Epub 2011 May 1. 21532585
  13. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  14. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  15. Wen H, Li J, Song T, Lu M, Kan PY, Lee MG, Sha B, Shi X: Recognition of histone H3K4 trimethylation by the plant homeodomain of PHF2 modulates histone demethylation. J Biol Chem. 2010 Mar 26;285(13):9322-6. doi: 10.1074/jbc.C109.097667. Epub 2010 Feb 2. 20129925
  16. Horton JR, Upadhyay AK, Hashimoto H, Zhang X, Cheng X: Structural basis for human PHF2 Jumonji domain interaction with metal ions. J Mol Biol. 2011 Feb 11;406(1):1-8. doi: 10.1016/j.jmb.2010.12.013. Epub 2010 Dec 15. 21167174