You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGlycine receptor subunit alpha-3
Synonyms
  • Glycine receptor subunit alpha-3 precursor
Gene NameGLRA3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0000825|Glycine receptor subunit alpha-3
MAHVRHFRTLVSGFYFWEAALLLSLVATKETDSARSRSAPMSPSDFLDKLMGRTSGYDAR
IRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDP
SMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPM
DVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNTGKF
TCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQS
SGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEA
FALEKFYRFSDMDDEVRESRFSFTAYGMGPCLQAKDGMTPKGPNHPVQVMPKSPDEMRKV
FIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRHEDIHQQQD
Number of residues464
Molecular Weight53799.775
Theoretical pI8.51
GO Classification
Functions
  • extracellular-glycine-gated chloride channel activity
  • transmitter-gated ion channel activity
  • glycine binding
Processes
  • neuropeptide signaling pathway
  • gamma-aminobutyric acid receptor clustering
  • synaptic transmission, glycinergic
  • transmembrane transport
  • ion transmembrane transport
  • chloride transmembrane transport
  • response to amino acid
  • regulation of membrane potential
  • neurological system process
Components
  • plasma membrane
  • cell junction
  • external side of plasma membrane
  • integral component of plasma membrane
  • axon terminus
  • synapse
  • neuron projection
  • chloride channel complex
  • postsynaptic membrane
General FunctionTransmitter-gated ion channel activity
Specific FunctionThe glycine receptor is a neurotransmitter-gated ion channel. Binding of glycine to its receptor increases the chloride conductance and thus produces hyperpolarization (inhibition of neuronal firing).
Pfam Domain Function
Transmembrane Regions253-279 286-303 315-341 434-451
GenBank Protein ID3342792
UniProtKB IDO75311
UniProtKB Entry NameGLRA3_HUMAN
Cellular LocationCell junction
Gene sequence
>lcl|BSEQ0010287|Glycine receptor subunit alpha-3 (GLRA3)
ATGGCCCACGTGAGACACTTTCGGACATTAGTTTCGGGATTTTACTTCTGGGAAGCAGCA
CTGTTACTCAGTTTGGTTGCCACAAAGGAAACAGACAGTGCAAGATCTCGAAGTGCTCCA
ATGTCACCTTCTGATTTTCTGGATAAATTAATGGGCAGGACATCAGGATATGATGCAAGA
ATCAGACCCAATTTTAAAGGCCCTCCAGTTAATGTCACATGCAACATATTCATCAACAGC
TTTGGCTCTATCGCAGAGACGACCATGGATTACAGAGTGAATATCTTTCTTCGTCAGAAA
TGGAATGATCCCCGCCTCGCGTACAGTGAATATCCTGACGACTCTTTAGACCTCGACCCC
TCCATGTTGGACTCCATTTGGAAACCTGATTTGTTCTTTGCCAATGAAAAGGGTGCCAAC
TTTCATGAAGTCACTACAGACAACAAATTGCTAAGAATTTTCAAAAATGGAAATGTTCTT
TATTCAATAAGATTAACATTAACACTTTCCTGTCCAATGGATCTCAAGAATTTTCCCATG
GATGTACAAACATGTATAATGCAACTGGAAAGCTTTGGGTACACAATGAATGATCTCATT
TTTGAATGGCAAGATGAGGCACCCGTACAAGTGGCAGAAGGACTCACTTTGCCCCAGTTT
CTGTTGAAAGAAGAAAAAGATTTACGATACTGCACTAAACATTACAATACAGGAAAGTTT
ACGTGTATAGAAGTGCGATTCCATCTGGAGCGACAAATGGGATACTATCTGATCCAGATG
TACATTCCCAGTCTCCTGATTGTTATTCTATCCTGGGTTTCATTCTGGATCAACATGGAT
GCAGCACCGGCCAGGGTAGCTCTGGGGATAACCACTGTGCTAACGATGACTACACAGAGT
TCAGGATCACGAGCTTCCTTGCCAAAAGTTTCATATGTCAAAGCTATTGATATTTGGATG
GCAGTATGCCTCCTTTTTGTGTTTTCAGCACTTCTGGAGTATGCAGCTGTAAATTTTGTA
TCAAGACAACACAAAGAACTTCTGAGATTTCGACGAAAGAGAAAGAATAAGGATGATGAG
GTAAGGGAAAGCCGATTCAGCTTCACAGCCTATGGAATGGGACCATGTCTACAAGCAAAG
GATGGCATGACTCCAAAGGGCCCCAACCACCCTGTCCAGGTAATGCCAAAAAGTCCTGAT
GAAATGAGGAAGGTCTTTATCGACCGGGCCAAGAAGATTGATACCATCTCCCGAGCCTGC
TTCCCATTAGCTTTTTTGATTTTTAATATTTTCTACTGGGTTATCTATAAAATTCTTAGG
CATGAGGATATTCATCAGCAGCAAGATTAA
GenBank Gene IDAF017724
GeneCard IDNot Available
GenAtlas IDGLRA3
HGNC IDHGNC:4328
Chromosome Location4
Locus4q33-q34
References
  1. Nikolic Z, Laube B, Weber RG, Lichter P, Kioschis P, Poustka A, Mulhardt C, Becker CM: The human glycine receptor subunit alpha3. Glra3 gene structure, chromosomal localization, and functional characterization of alternative transcripts. J Biol Chem. 1998 Jul 31;273(31):19708-14. 9677400
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334