Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTransient receptor potential cation channel subfamily A member 1
Synonyms
  • ANKTM1
  • Ankyrin-like with transmembrane domains protein 1
  • Transformation-sensitive protein p120
Gene NameTRPA1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0016320|Transient receptor potential cation channel subfamily A member 1
MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLKRCD
DMDTFFLHYAAAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSR
GANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEA
LQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKA
TPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVD
IVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNL
LLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYA
CRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDL
HGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKC
TDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTII
RSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNF
KYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHM
MNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLIKTCMILVFLS
SIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVY
FYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSS
PLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLA
VGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIF
CFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETED
DDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP
Number of residues1119
Molecular Weight127499.88
Theoretical pI6.98
GO Classification
Functions
  • intracellular ligand-gated calcium channel activity
  • channel activity
  • temperature-gated cation channel activity
Processes
  • response to organic substance
  • detection of mechanical stimulus involved in sensory perception of pain
  • transmembrane transport
  • response to organic cyclic compound
  • response to hydrogen peroxide
  • ion transmembrane transport
  • cell surface receptor signaling pathway
  • protein homotetramerization
  • detection of chemical stimulus involved in sensory perception of pain
  • sensory perception of pain
  • thermoception
  • ion transport
  • calcium ion transmembrane transport
  • response to drug
  • response to pain
  • response to cold
Components
  • integral component of plasma membrane
  • stereocilium bundle
  • plasma membrane
General FunctionTemperature-gated cation channel activity
Specific FunctionReceptor-activated non-selective cation channel involved in detection of pain and possibly also in cold perception and inner ear function (PubMed:25389312, PubMed:25855297). Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of volatile irritants, such as mustard oil, cinnamaldehyde, garlic and acrolein, an irritant from tears gas and vehicule exhaust fumes (PubMed:25389312, PubMed:20547126). Is also activated by menthol (in vitro)(PubMed:25389312). Acts also as a ionotropic cannabinoid receptor by being activated by delta(9)-tetrahydrocannabinol (THC), the psychoactive component of marijuana (PubMed:25389312). May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system (By similarity).
Pfam Domain Function
Transmembrane Regions720-740 765-785 804-824 830-850 874-894 935-956
GenBank Protein ID3287188
UniProtKB IDO75762
UniProtKB Entry NameTRPA1_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0016321|Transient receptor potential cation channel subfamily A member 1 (TRPA1)
ATGAAGCGCAGCCTGAGGAAGATGTGGCGCCCTGGAGAAAAGAAGGAGCCCCAGGGCGTT
GTCTATGAGGATGTGCCGGACGACACGGAGGATTTCAAGGAATCGCTTAAGGTGGTTTTT
GAAGGAAGTGCATATGGATTACAAAACTTTAATAAGCAAAAGAAATTAAAAAGATGTGAC
GATATGGACACCTTCTTCTTGCATTATGCTGCAGCAGAAGGCCAAATTGAGCTAATGGAG
AAGATCACCAGAGATTCCTCTTTGGAAGTGCTGCATGAAATGGATGATTATGGAAATACC
CCTCTGCATTGTGCTGTAGAAAAAAACCAAATTGAAAGCGTTAAGTTTCTTCTCAGCAGA
GGAGCAAACCCAAATCTCCGAAACTTCAACATGATGGCTCCTCTCCACATAGCTGTGCAG
GGCATGAATAATGAGGTGATGAAGGTCTTGCTTGAGCATAGAACTATTGATGTTAATTTG
GAAGGAGAAAATGGAAACACAGCTGTGATCATTGCGTGCACCACAAATAATAGCGAAGCA
TTGCAGATTTTGCTTAAAAAAGGAGCTAAGCCATGTAAATCAAATAAATGGGGATGTTTC
CCTATTCACCAAGCTGCATTTTCAGGTTCCAAAGAATGCATGGAAATAATACTAAGGTTT
GGTGAAGAGCATGGGTACAGTAGACAGTTGCACATTAACTTTATGAATAATGGGAAAGCC
ACCCCTCTCCACCTGGCTGTGCAAAATGGTGACTTGGAAATGATCAAAATGTGCCTGGAC
AATGGTGCACAAATAGACCCAGTGGAGAAGGGAAGGTGCACAGCCATTCATTTTGCTGCC
ACCCAGGGAGCCACTGAGATTGTTAAACTGATGATATCGTCCTATTCTGGTAGCGTGGAT
ATTGTTAACACAACCGATGGATGTCATGAGACCATGCTTCACAGAGCTTCATTGTTTGAT
CACCATGAGCTAGCAGACTATTTAATTTCAGTGGGAGCAGATATTAATAAGATCGATTCT
GAAGGACGCTCTCCACTTATATTAGCAACTGCTTCTGCATCTTGGAATATTGTAAATTTG
CTACTCTCTAAAGGTGCCCAAGTAGACATAAAAGATAATTTTGGACGTAATTTTCTGCAT
TTAACTGTACAGCAACCTTATGGATTAAAAAATCTGCGACCTGAATTTATGCAGATGCAA
CAGATCAAAGAGCTGGTAATGGATGAAGACAACGATGGGTGTACTCCTCTACATTATGCA
TGTAGACAGGGGGGCCCTGGTTCTGTAAATAACCTACTTGGCTTTAATGTGTCCATTCAT
TCCAAAAGCAAAGATAAGAAATCACCTCTGCATTTTGCAGCCAGTTATGGGCGTATCAAT
ACCTGTCAGAGGCTCCTACAAGACATAAGTGATACGAGGCTTCTGAATGAAGGTGACCTT
CATGGAATGACTCCTCTCCATCTGGCAGCAAAGAATGGACATGATAAAGTAGTTCAGCTT
CTTCTGAAAAAAGGTGCATTGTTTCTCAGTGACCACAATGGCTGGACAGCTTTGCATCAT
GCGTCCATGGGCGGGTACACTCAGACCATGAAGGTCATTCTTGATACTAATTTGAAGTGC
ACAGATCGCCTGGATGAAGACGGGAACACTGCACTTCACTTTGCTGCAAGGGAAGGCCAC
GCCAAAGCCGTTGCGCTTCTTCTGAGCCACAATGCTGACATAGTCCTGAACAAGCAGCAG
GCCTCCTTTTTGCACCTTGCACTTCACAATAAGAGGAAGGAGGTTGTTCTTACGATCATC
AGGAGCAAAAGATGGGATGAATGTCTTAAGATTTTCAGTCATAATTCTCCAGGCAATAAA
TGTCCAATTACAGAAATGATAGAATACCTCCCTGAATGCATGAAGGTACTTTTAGATTTC
TGCATGTTGCATTCCACAGAAGACAAGTCCTGCCGAGACTATTATATCGAGTATAATTTC
AAATATCTTCAATGTCCATTAGAATTCACCAAAAAAACACCTACACAGGATGTTATATAT
GAACCGCTTACAGCCCTCAACGCAATGGTACAAAATAACCGCATAGAGCTTCTCAATCAT
CCTGTGTGTAAAGAATATTTACTCATGAAATGGTTGGCTTATGGATTTAGAGCTCATATG
ATGAATTTAGGATCTTACTGTCTTGGTCTCATACCTATGACCATTCTCGTTGTCAATATA
AAACCAGGAATGGCTTTCAACTCAACTGGCATCATCAATGAAACTAGTGATCATTCAGAA
ATACTAGATACCACGAATTCATATCTAATAAAAACTTGTATGATTTTAGTGTTTTTATCA
AGTATATTTGGGTATTGCAAAGAAGCGGGGCAAATTTTCCAACAGAAAAGGAATTATTTT
ATGGATATAAGCAATGTTCTTGAATGGATTATCTACACGACGGGCATCATTTTTGTGCTG
CCCTTGTTTGTTGAAATACCAGCTCATCTGCAGTGGCAATGTGGAGCAATTGCTGTTTAC
TTCTATTGGATGAATTTCTTATTGTATCTTCAAAGATTTGAAAATTGTGGAATTTTTATT
GTTATGTTGGAGGTAATTTTGAAAACTTTGTTGAGGTCTACAGTTGTATTTATCTTCCTT
CTTCTGGCTTTTGGACTCAGCTTTTACATCCTCCTGAATTTACAGGATCCCTTCAGCTCT
CCATTGCTTTCTATAATCCAGACCTTCAGCATGATGCTAGGAGATATCAATTATCGAGAG
TCCTTCCTAGAACCATATCTGAGAAATGAATTGGCACATCCAGTTCTGTCCTTTGCACAA
CTTGTTTCCTTCACAATATTTGTCCCAATTGTCCTCATGAATTTACTTATTGGTTTGGCA
GTTGGCGACATTGCTGAGGTCCAGAAACATGCATCATTGAAGAGGATAGCTATGCAGGTG
GAACTTCATACCAGCTTAGAGAAGAAGCTGCCACTTTGGTTTCTACGCAAAGTGGATCAG
AAATCCACCATCGTGTATCCCAACAAACCCAGATCTGGTGGGATGTTATTCCATATATTC
TGTTTTTTATTTTGCACTGGGGAAATAAGACAAGAAATACCAAATGCTGATAAATCTTTA
GAAATGGAAATATTAAAGCAGAAATACCGGCTGAAGGATCTTACTTTTCTCCTGGAAAAA
CAGCATGAGCTCATTAAACTGATCATTCAGAAGATGGAGATCATCTCTGAGACAGAGGAT
GATGATAGCCATTGTTCTTTTCAAGACAGGTTTAAGAAAGAGCAGATGGAACAAAGGAAT
AGCAGATGGAATACTGTGTTGAGAGCAGTCAAGGCAAAAACACACCATCTTGAGCCTTAG
GenBank Gene IDY10601
GeneCard IDNot Available
GenAtlas IDTRPA1
HGNC IDHGNC:497
Chromosome Location8
Locus8q13
References
  1. Jaquemar D, Schenker T, Trueb B: An ankyrin-like protein with transmembrane domains is specifically lost after oncogenic transformation of human fibroblasts. J Biol Chem. 1999 Mar 12;274(11):7325-33. 10066796
  2. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. 16421571
  3. Moparthi L, Survery S, Kreir M, Simonsen C, Kjellbom P, Hogestatt ED, Johanson U, Zygmunt PM: Human TRPA1 is intrinsically cold- and chemosensitive with and without its N-terminal ankyrin repeat domain. Proc Natl Acad Sci U S A. 2014 Nov 25;111(47):16901-6. doi: 10.1073/pnas.1412689111. Epub 2014 Nov 11. 25389312
  4. Paulsen CE, Armache JP, Gao Y, Cheng Y, Julius D: Structure of the TRPA1 ion channel suggests regulatory mechanisms. Nature. 2015 Apr 23;520(7548):511-7. doi: 10.1038/nature14367. Epub 2015 Apr 8. 25855297
  5. Kremeyer B, Lopera F, Cox JJ, Momin A, Rugiero F, Marsh S, Woods CG, Jones NG, Paterson KJ, Fricker FR, Villegas A, Acosta N, Pineda-Trujillo NG, Ramirez JD, Zea J, Burley MW, Bedoya G, Bennett DL, Wood JN, Ruiz-Linares A: A gain-of-function mutation in TRPA1 causes familial episodic pain syndrome. Neuron. 2010 Jun 10;66(5):671-80. doi: 10.1016/j.neuron.2010.04.030. 20547126