You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameLysine-specific demethylase 4B
Synonyms
  • 1.14.11.-
  • JHDM3B
  • JmjC domain-containing histone demethylation protein 3B
  • JMJD2B
  • Jumonji domain-containing protein 2B
  • KIAA0876
Gene NameKDM4B
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037294|Lysine-specific demethylase 4B
MGSEDHGAQNPSCKIMTFRPTMEEFKDFNKYVAYIESQGAHRAGLAKIIPPKEWKPRQTY
DDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLER
KYWKNLTFVSPIYGADISGSLYDDDVAQWNIGSLRTILDMVERECGTIIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAIGFFPGSSQGCDAFLR
HKMTLISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATLRWIDY
GKVATQCTCRKDMVKISMDVFVRILQPERYELWKQGKDLTVLDHTRPTALTSPELSSWSA
SRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSVKEEAGPEVDPEE
EEEEPQPLPHGREAEGAEEDGRGKLRPTKAKSERKKKSFGLLPPQLPPPPAHFPSEEALW
LPSPLEPPVLGPGPAAMEESPLPAPLNVVPPEVPSEELEAKPRPIIPMLYVVPRPGKAAF
NQEHVSCQQAFEHFAQKGPTWKEPVSPMELTGPEDGAASSGAGRMETKARAGEGQAPSTF
SKLKMEIKKSRRHPLGRPPTRSPLSVVKQEASSDEEASPFSGEEDVSDPDALRPLLSLQW
KNRAASFQAERKFNAAAARTEPYCAICTLFYPYCQALQTEKEAPIASLGKGCPATLPSKS
RQKTRPLIPEMCFTSGGENTEPLPANSYIGDDGTSPLIACGKCCLQVHASCYGIRPELVN
EGWTCSRCAAHAWTAECCLCNLRGGALQMTTDRRWIHVICAIAVPEARFLNVIERHPVDI
SAIPEQRWKLKCVYCRKRMKKVSGACIQCSYEHCSTSFHVTCAHAAGVLMEPDDWPYVVS
ITCLKHKSGGHAVQLLRAVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDN
LYPESITSRDCVQLGPPSEGELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKR
GDIFTLEEELPKRVRSRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVA
FVESLLQVQGRPGAPF
Number of residues1096
Molecular Weight121895.515
Theoretical pINot Available
GO Classification
Functions
  • dioxygenase activity
  • zinc ion binding
Processes
  • transcription, DNA-templated
  • chromatin modification
  • chromatin organization
  • DNA repair
  • double-strand break repair
  • regulation of transcription, DNA-templated
Components
  • cytoplasm
  • nucleus
  • nucleoplasm
General FunctionZinc ion binding
Specific FunctionHistone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27', H3 'Lys-36' nor H4 'Lys-20'. Only able to demethylate trimethylated H3 'Lys-9', with a weaker activity than KDM4A, KDM4C and KDM4D. Demethylation of Lys residue generates formaldehyde and succinate.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDO94953
UniProtKB Entry NameKDM4B_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0013963|Lysine-specific demethylase 4B (KDM4B)
ATGGGGTCTGAGGACCACGGCGCCCAGAACCCCAGCTGTAAAATCATGACGTTTCGCCCA
ACCATGGAAGAATTTAAAGACTTCAACAAATACGTGGCCTACATAGAGTCGCAGGGAGCC
CACCGGGCGGGCCTGGCCAAGATCATCCCCCCGAAGGAGTGGAAGCCGCGGCAGACGTAT
GATGACATCGACGACGTGGTGATCCCGGCGCCCATCCAGCAGGTGGTGACGGGCCAGTCG
GGCCTCTTCACGCAGTACAATATCCAGAAGAAGGCCATGACAGTGGGCGAGTACCGCCGC
CTGGCCAACAGCGAGAAGTACTGTACCCCGCGGCACCAGGACTTTGATGACCTTGAACGC
AAATACTGGAAGAACCTCACCTTTGTCTCCCCGATCTACGGGGCTGACATCAGCGGCTCT
TTGTATGATGACGACGTGGCCCAGTGGAACATCGGGAGCCTCCGGACCATCCTGGACATG
GTGGAGCGCGAGTGCGGCACCATCATCGAGGGCGTGAACACGCCCTACCTGTACTTCGGC
ATGTGGAAGACCACCTTCGCCTGGCACACCGAGGACATGGACCTGTACAGCATCAACTAC
CTGCACTTTGGGGAGCCTAAGTCCTGGTACGCCATCCCACCAGAGCACGGCAAGCGCCTG
GAGCGGCTGGCCATCGGCTTCTTCCCCGGGAGCTCGCAGGGCTGCGACGCCTTCCTGCGG
CATAAGATGACCCTCATCTCGCCCATCATCCTGAAGAAGTACGGGATCCCCTTCAGCCGG
ATCACGCAGGAGGCCGGGGAATTCATGATCACATTTCCCTACGGCTACCACGCCGGCTTC
AATCACGGGTTCAACTGCGCAGAATCTACCAACTTCGCCACCCTGCGGTGGATTGACTAC
GGCAAAGTGGCCACTCAGTGCACGTGCCGGAAGGACATGGTCAAGATCTCCATGGACGTG
TTCGTGCGCATCCTGCAGCCCGAGCGCTACGAGCTGTGGAAGCAGGGCAAGGACCTCACG
GTGCTGGACCACACGCGGCCCACGGCGCTCACCAGCCCCGAGCTGAGCTCCTGGAGTGCA
TCCCGGGCCTCGCTGAAGGCCAAGCTCCTCCGCAGGTCTCACCGGAAACGGAGCCAGCCC
AAGAAGCCGAAGCCCGAAGACCCCAAGTTCCCTGGGGAGGGTACGGCTGGGGCAGCGCTC
CTAGAGGAGGCTGGGGGCAGCGTGAAGGAGGAGGCTGGGCCGGAGGTTGACCCCGAGGAG
GAGGAGGAGGAGCCGCAGCCACTGCCACACGGCCGGGAGGCCGAGGGCGCAGAAGAGGAC
GGGAGGGGCAAGCTGCGGCCAACCAAGGCCAAGAGCGAGCGGAAGAAGAAGAGCTTCGGC
CTGCTGCCCCCACAGCTGCCGCCCCCGCCTGCTCACTTCCCCTCAGAGGAGGCGCTGTGG
CTGCCATCCCCACTGGAGCCCCCGGTGCTGGGCCCAGGCCCTGCAGCCATGGAGGAGAGC
CCCCTGCCGGCACCCCTTAATGTCGTGCCCCCTGAGGTGCCCAGTGAGGAGCTAGAGGCC
AAGCCTCGGCCCATCATCCCCATGCTGTACGTGGTGCCGCGGCCGGGCAAGGCAGCCTTC
AACCAGGAGCACGTGTCCTGCCAGCAGGCCTTTGAGCACTTTGCCCAGAAGGGTCCGACC
TGGAAGGAACCAGTTTCCCCCATGGAGCTGACGGGGCCAGAGGACGGTGCAGCCAGCAGT
GGGGCAGGTCGCATGGAGACCAAAGCCCGGGCCGGAGAGGGGCAGGCACCGTCCACATTT
TCCAAATTGAAGATGGAGATCAAGAAGAGCCGGCGCCATCCCCTGGGCCGGCCGCCCACC
CGGTCCCCACTGTCGGTGGTGAAGCAGGAGGCCTCAAGTGACGAGGAGGCATCCCCTTTC
TCCGGGGAGGAAGATGTGAGTGACCCGGACGCCTTGAGGCCGCTGCTGTCTCTGCAGTGG
AAGAACAGGGCGGCCAGCTTCCAGGCCGAGAGGAAGTTCAACGCAGCGGCTGCGCGCACG
GAGCCCTACTGCGCCATCTGCACGCTCTTCTACCCCTACTGCCAGGCCCTACAGACTGAG
AAGGAGGCACCCATAGCCTCCCTCGGAGAGGGCTGCCCGGCCACATTACCCTCCAAAAGC
CGTCAGAAGACCCGACCGCTCATCCCTGAGATGTGCTTCACCTCTGGCGGTGAGAACACG
GAGCCGCTGCCTGCCAACTCCTACATCGGCGACGACGGGACCAGCCCCCTGATCGCCTGC
GGCAAGTGCTGCCTGCAGGTCCATGCCAGTTGCTATGGCATCCGTCCCGAGCTGGTCAAT
GAAGGCTGGACGTGTTCCCGGTGCGCGGCCCACGCCTGGACTGCGGAGTGCTGCCTGTGC
AACCTGCGAGGAGGTGCGCTGCAGATGACCACCGATAGGAGGTGGATCCACGTGATCTGT
GCCATCGCAGTCCCCGAGGCGCGCTTCCTGAACGTGATTGAGCGCCACCCTGTGGACATC
AGCGCCATCCCCGAGCAGCGGTGGAAGCTGAAATGCGTGTACTGCCGGAAGCGGATGAAG
AAGGTGTCAGGTGCCTGTATCCAGTGCTCCTACGAGCACTGCTCCACGTCCTTCCACGTG
ACCTGCGCCCACGCCGCAGGCGTGCTCATGGAGCCGGACGACTGGCCCTATGTGGTCTCC
ATCACCTGCCTCAAGCACAAGTCGGGGGGTCACGCTGTCCAACTCCTGAGGGCCGTGTCC
CTAGGCCAGGTGGTCATCACCAAGAACCGCAACGGGCTGTACTACCGCTGTCGCGTCATC
GGTGCCGCCTCGCAGACCTGCTACGAAGTGAACTTCGACGATGGCTCCTACAGCGACAAC
CTGTACCCTGAGAGCATCACGAGTAGGGACTGTGTCCAGCTGGGACCCCCTTCCGAGGGG
GAGCTGGTGGAGCTCCGGTGGACTGACGGCAACCTCTACAAGGCCAAGTTCATCTCCTCC
GTCACCAGCCACATCTACCAGGTGGAGTTTGAGGACGGGTCCCAGCTGACGGTGAAGCGT
GGGGACATCTTCACCCTGGAGGAGGAGCTGCCCAAGAGGGTCCGCTCTCGGCTGTCACTG
AGCACGGGGGCACCGCAGGAGCCCGCCTTCTCGGGGGAGGAGGCCAAGGCCGCCAAGCGC
CCGCGTGTGGGCACCCCGCTTGCCACGGAGGACTCCGGGCGGAGCCAGGACTACGTGGCC
TTCGTGGAGAGCCTCCTGCAGGTGCAGGGCCGGCCCGGAGCCCCCTTCTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:29136
Chromosome Location19
LocusNot Available
References
  1. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Dec 31;5(6):355-64. 10048485
  2. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. 12168954
  3. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. 15057824
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  6. Gray SG, Iglesias AH, Lizcano F, Villanueva R, Camelo S, Jingu H, Teh BT, Koibuchi N, Chin WW, Kokkotou E, Dangond F: Functional characterization of JMJD2A, a histone deacetylase- and retinoblastoma-binding protein. J Biol Chem. 2005 Aug 5;280(31):28507-18. Epub 2005 May 31. 15927959
  7. Whetstine JR, Nottke A, Lan F, Huarte M, Smolikov S, Chen Z, Spooner E, Li E, Zhang G, Colaiacovo M, Shi Y: Reversal of histone lysine trimethylation by the JMJD2 family of histone demethylases. Cell. 2006 May 5;125(3):467-81. Epub 2006 Apr 6. 16603238
  8. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  9. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. 19608861
  10. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569