You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameProtein phosphatase 1 regulatory subunit 3D
Synonyms
  • PP1 subunit R6
  • PPP1R6
  • Protein phosphatase 1 regulatory subunit 6
  • Protein phosphatase 1-binding subunit R6
Gene NamePPP1R3D
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013631|Protein phosphatase 1 regulatory subunit 3D
MSRGPSSAVLPSALGSRKLGPRSLSCLSDLDGGVALEPRACRPPGSPGRAPPPTPAPSGC
DPRLRPIILRRARSLPSSPERRQKAAGAPGAACRPGCSQKLRVRFADALGLELAQVKVFN
AGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLHCLVPDFPPPVEAADFGERLQRQLVCLE
RVTCSDLGISGTVRVCNVAFEKQVAVRYTFSGWRSTHEAVARWRGPAGPEGTEDVFTFGF
PVPPFLLELGSRVHFAVRYQVAGAEYWDNNDHRDYSLTCRNHALHMPRGECEESWIHFI
Number of residues299
Molecular Weight32558.72
Theoretical pINot Available
GO Classification
Functions
  • protein serine/threonine phosphatase activity
Processes
  • glycogen metabolic process
  • protein dephosphorylation
  • regulation of glycogen biosynthetic process
  • regulation of glycogen catabolic process
Components
  • intracellular membrane-bounded organelle
  • glycogen granule
General FunctionProtein serine/threonine phosphatase activity
Specific FunctionSeems to act as a glycogen-targeting subunit for PP1. PP1 is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDO95685
UniProtKB Entry NamePPR3D_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0013632|Protein phosphatase 1 regulatory subunit 3D (PPP1R3D)
ATGTCCAGAGGCCCGAGCTCCGCGGTCCTGCCTAGCGCCCTGGGATCCCGGAAGCTCGGC
CCCCGGAGCCTCAGCTGCCTGTCGGACCTGGACGGCGGCGTGGCCCTGGAGCCGCGGGCC
TGTAGGCCCCCTGGGAGCCCGGGCCGCGCGCCGCCGCCAACGCCAGCGCCGTCGGGCTGC
GACCCCCGCCTGCGGCCCATCATCCTGCGGCGGGCGCGCTCACTGCCCAGCTCCCCCGAG
CGCCGCCAGAAGGCCGCGGGCGCGCCGGGCGCTGCGTGTCGGCCGGGCTGCAGCCAGAAG
CTCCGCGTGCGCTTCGCCGACGCCCTGGGCTTGGAGCTGGCACAGGTCAAGGTGTTCAAC
GCGGGAGACGACCCGTCCGTGCCGCTGCACGTGCTGTCGCGGCTCGCAATCAACTCGGAC
CTGTGCTGCAGCAGCCAGGACCTGGAGTTCACCCTGCATTGCCTGGTGCCCGATTTCCCG
CCGCCCGTCGAGGCCGCCGACTTTGGCGAGCGCCTGCAGCGGCAGCTCGTGTGCCTGGAG
CGTGTCACTTGCTCGGACCTTGGCATCAGCGGTACGGTGCGCGTGTGCAACGTGGCCTTC
GAGAAGCAGGTGGCTGTGCGCTACACTTTCTCGGGCTGGCGCAGTACCCACGAGGCGGTG
GCGCGGTGGCGCGGGCCCGCAGGCCCCGAGGGCACGGAGGACGTTTTCACCTTCGGCTTT
CCAGTACCGCCCTTCCTGCTGGAGCTCGGCTCCCGCGTGCACTTCGCGGTGCGCTACCAA
GTGGCGGGTGCCGAGTACTGGGACAACAACGACCACCGAGACTACAGCCTCACATGTCGC
AACCACGCGCTGCACATGCCTCGCGGGGAGTGCGAAGAGAGCTGGATCCACTTCATCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9294
Chromosome Location20
LocusNot Available
References
  1. Armstrong CG, Browne GJ, Cohen P, Cohen PT: PPP1R6, a novel member of the family of glycogen-targetting subunits of protein phosphatase 1. FEBS Lett. 1997 Nov 24;418(1-2):210-4. 9414128
  2. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. 11780052
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Worby CA, Gentry MS, Dixon JE: Laforin, a dual specificity phosphatase that dephosphorylates complex carbohydrates. J Biol Chem. 2006 Oct 13;281(41):30412-8. Epub 2006 Aug 10. 16901901
  5. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  6. Rubio-Villena C, Garcia-Gimeno MA, Sanz P: Glycogenic activity of R6, a protein phosphatase 1 regulatory subunit, is modulated by the laforin-malin complex. Int J Biochem Cell Biol. 2013 Jul;45(7):1479-88. doi: 10.1016/j.biocel.2013.04.019. Epub 2013 Apr 26. 23624058