NameIg gamma-2 chain C region
SynonymsNot Available
Gene NameIGHG2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017230|Ig gamma-2 chain C region
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVF
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFR
VVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKN
QVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGN
VFSCSVMHEALHNHYTQKSLSLSPGK
Number of residues326
Molecular Weight35900.445
Theoretical pI7.66
GO Classification
Functions
  • antigen binding
  • immunoglobulin receptor binding
Processes
  • Fc-epsilon receptor signaling pathway
  • receptor-mediated endocytosis
  • defense response to bacterium
  • phagocytosis, engulfment
  • B cell receptor signaling pathway
  • complement activation, classical pathway
  • phagocytosis, recognition
  • positive regulation of B cell activation
  • complement activation
  • Fc-gamma receptor signaling pathway involved in phagocytosis
  • innate immune response
Components
  • external side of plasma membrane
  • blood microparticle
  • immunoglobulin complex, circulating
  • extracellular region
  • extracellular space
  • extracellular exosome
General FunctionImmunoglobulin receptor binding
Specific FunctionNot Available
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP01859
UniProtKB Entry NameIGHG2_HUMAN
Cellular LocationSecreted
Gene sequenceNot Available
GenBank Gene IDAL928742
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:5526
Chromosome LocationNot Available
Locus14q32.33
References
  1. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. 12508121
  2. Ellison J, Hood L: Linkage and sequence homology of two human immunoglobulin gamma heavy chain constant region genes. Proc Natl Acad Sci U S A. 1982 Mar;79(6):1984-8. 6804948
  3. Takahashi N, Ueda S, Obata M, Nikaido T, Nakai S, Honjo T: Structure of human immunoglobulin gamma genes: implications for evolution of a gene family. Cell. 1982 Jun;29(2):671-9. 6811139
  4. Krawinkel U, Rabbitts TH: Comparison of the hinge-coding segments in human immunoglobulin gamma heavy chain genes and the linkage of the gamma 2 and gamma 4 subclass genes. EMBO J. 1982;1(4):403-7. 6329676
  5. Wang AC, Tung E, Fudenberg HH: The primary structure of a human IgG2 heavy chain: genetic, evolutionary, and functional implications. J Immunol. 1980 Sep;125(3):1048-54. 6774012
  6. Connell GE, Parr DM, Hofmann T: The amino acid sequences of the three heavy chain constant region domains of a human IgG2 myeloma protein. Can J Biochem. 1979 Jun;57(6):758-67. 113060
  7. Hofmann T, Parr DM: A note of the amino acid sequence of residues 381--391 of human immunoglobulins gamma chains. Mol Immunol. 1979 Nov;16(11):923-5. 118920
  8. Stoppini M, Bellotti V, Negri A, Merlini G, Garver F, Ferri G: Characterization of the two unique human anti-flavin monoclonal immunoglobulins. Eur J Biochem. 1995 Mar 15;228(3):886-93. 7737190
  9. Milstein C, Frangione B: Disulphide bridges of the heavy chain of human immunoglobulin G2. Biochem J. 1971 Jan;121(2):217-25. 4940472
  10. Frangione B, Milstein C, Pink JR: Structural studies of immunoglobulin G. Nature. 1969 Jan 11;221(5176):145-8. 5782707
  11. Kristiansen TZ, Bunkenborg J, Gronborg M, Molina H, Thuluvath PJ, Argani P, Goggins MG, Maitra A, Pandey A: A proteomic analysis of human bile. Mol Cell Proteomics. 2004 Jul;3(7):715-28. Epub 2004 Apr 14. 15084671
  12. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. 19159218
  13. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. 19139490