You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameHemoglobin subunit epsilon
Synonyms
  • Epsilon-globin
  • HBE
  • Hemoglobin epsilon chain
Gene NameHBE1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017577|Hemoglobin subunit epsilon
MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPK
VKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFG
KEFTPEVQAAWQKLVSAVAIALAHKYH
Number of residues147
Molecular Weight16202.71
Theoretical pINot Available
GO Classification
Functions
  • oxygen transporter activity
  • iron ion binding
  • heme binding
  • oxygen binding
Processes
  • negative regulation of transcription from RNA polymerase II promoter
  • protein heterooligomerization
  • blood coagulation
Components
  • hemoglobin complex
  • cytosol
  • blood microparticle
General FunctionOxygen transporter activity
Specific FunctionThe epsilon chain is a beta-type chain of early mammalian embryonic hemoglobin.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP02100
UniProtKB Entry NameHBE_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0017578|Hemoglobin subunit epsilon (HBE1)
ATGGTGCATTTTACTGCTGAGGAGAAGGCTGCCGTCACTAGCCTGTGGAGCAAGATGAAT
GTGGAAGAGGCTGGAGGTGAAGCCTTGGGCAGACTCCTCGTTGTTTACCCCTGGACCCAG
AGATTTTTTGACAGCTTTGGAAACCTGTCGTCTCCCTCTGCCATCCTGGGCAACCCCAAG
GTCAAGGCCCATGGCAAGAAGGTGCTGACTTCCTTTGGAGATGCTATTAAAAACATGGAC
AACCTCAAGCCCGCCTTTGCTAAGCTGAGTGAGCTGCACTGTGACAAGCTGCATGTGGAT
CCTGAGAACTTCAAGCTCCTGGGTAACGTGATGGTGATTATTCTGGCTACTCACTTTGGC
AAGGAGTTCACCCCTGAAGTGCAGGCTGCCTGGCAGAAGCTGGTGTCTGCTGTCGCCATT
GCCCTGGCCCATAAGTACCACTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:4830
Chromosome Location11
LocusNot Available
References
  1. Baralle FE, Shoulders CC, Proudfoot NJ: The primary structure of the human epsilon-globin gene. Cell. 1980 Oct;21(3):621-6. 6254663
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Clegg JB: Embryonic hemoglobin: sequence of the epsilon and zeta chains. Tex Rep Biol Med. 1980-1981;40:23-8. 6172865
  4. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  5. Sutherland-Smith AJ, Baker HM, Hofmann OM, Brittain T, Baker EN: Crystal structure of a human embryonic haemoglobin: the carbonmonoxy form of gower II (alpha2 epsilon2) haemoglobin at 2.9 A resolution. J Mol Biol. 1998 Jul 17;280(3):475-84. 9665850