You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameInterstitial collagenase
Synonyms
  • 3.4.24.7
  • CLG
  • Fibroblast collagenase
  • Matrix metalloproteinase-1
  • MMP-1
Gene NameMMP1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010647|Interstitial collagenase
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Number of residues469
Molecular Weight54006.61
Theoretical pI6.97
GO Classification
Functions
  • zinc ion binding
  • calcium ion binding
  • endopeptidase activity
  • metalloendopeptidase activity
Processes
  • extracellular matrix disassembly
  • extracellular matrix organization
  • leukocyte migration
  • cellular protein metabolic process
  • viral process
  • positive regulation of protein oligomerization
  • blood coagulation
  • proteolysis
  • collagen catabolic process
Components
  • proteinaceous extracellular matrix
  • extracellular region
General FunctionZinc ion binding
Specific FunctionCleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID30126
UniProtKB IDP03956
UniProtKB Entry NameMMP1_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0001831|1410 bp
ATGCACAGCTTTCCTCCACTGCTGCTGCTGCTGTTCTGGGGTGTGGTGTCTCACAGCTTC
CCAGCGACTCTAGAAACACAAGAGCAAGATGTGGACTTAGTCCAGAAATACCTGGAAAAA
TACTACAACCTGAAGAATGATGGGAGGCAAGTTGAAAAGCGGAGAAATAGTGGCCCAGTG
GTTGAAAAATTGAAGCAAATGCAGGAATTCTTTGGGCTGAAAGTGACTGGGAAACCAGAT
GCTGAAACCCTGAAGGTGATGAAGCAGCCCAGATGTGGAGTGCCTGATGTGGCTCAGTTT
GTCCTCACTGAGGGGAACCCTCGCTGGGAGCAAACACATCTGACCTACAGGATTGAAAAT
TACACGCCAGATTTGCCAAGAGCAGATGTGGACCATGCCATTGAGAAAGCCTTCCAACTC
TGGAGTAATGTCACACCTCTGACATTCACCAAGGTCTCTGAGGGTCAAGCAGACATCATG
ATATCTTTTGTCAGGGGAGATCATCGGGACAACTCTCCTTTTGATGGACCTGGAGGAAAT
CTTGCTCATGCTTTTCAACCAGGCCCAGGTATTGGAGGGGATGCTCATTTTGATGAAGAT
GAAAGGTGGACCAACAATTTCAGAGAGTACAACTTACATCGTGTTGCGGCTCATGAACTC
GGCCATTCTCTTGGACTCTCCCATTCTACTGATATCGGGGCTTTGATGTACCCTAGCTAC
ACCTTCAGTGGTGATGTTCAGCTAGCTCAGGATGACATTGATGGCATCCAAGCCATATAT
GGACGTTCCCAAAATCCTGTCCAGCCCATCGGCCCACAAACCCCAAAAGCATGTGACAGT
AAGCTAACCTTTGATGCTATAACTACGATTCGGGGAGAAGTGATGTTCTTTAAAGACAGA
TTCTACATGCGCACAAATCCCTTCTACCCGGAAGTTGAGCTCAATTTCATTTCTGTTTTC
TGGCCACAACTGCCAAATGGGCTTGAAGCTGCTTACGAATTTGCCGACAGAGATGAAGTC
CGGTTTTTCAAAGGGAATAAGTACTGGGCTGTTCAGGGACAGAATGTGCTACACGGATAC
CCCAAGGACATCTACAGCTCCTTTGGCTTCCCTAGAACTGTGAAGCATATCGATGCTGCT
CTTTCTGAGGAAAACACTGGAAAAACCTACTTCTTTGTTGCTAACAAATACTGGAGGTAT
GATGAATATAAACGATCTATGGATCCAGGTTATCCCAAAATGATAGCACATGACTTTCCT
GGAATTGGCCACAAAGTTGATGCAGTTTTCATGAAAGATGGATTTTTCTATTTCTTTCAT
GGAACAAGACAATACAAATTTGATCCTAAAACGAAGAGAATTTTGACTCTCCAGAAAGCT
AATAGCTGGTTCAACTGCAGGAAAAATTGA
GenBank Gene IDX54925
GeneCard IDNot Available
GenAtlas IDMMP1
HGNC IDHGNC:7155
Chromosome LocationNot Available
Locus11q22.3
References
  1. Templeton NS, Brown PD, Levy AT, Margulies IM, Liotta LA, Stetler-Stevenson WG: Cloning and characterization of human tumor cell interstitial collagenase. Cancer Res. 1990 Sep 1;50(17):5431-7. 2167156
  2. Whitham SE, Murphy G, Angel P, Rahmsdorf HJ, Smith BJ, Lyons A, Harris TJ, Reynolds JJ, Herrlich P, Docherty AJ: Comparison of human stromelysin and collagenase by cloning and sequence analysis. Biochem J. 1986 Dec 15;240(3):913-6. 3030290
  3. Goldberg GI, Wilhelm SM, Kronberger A, Bauer EA, Grant GA, Eisen AZ: Human fibroblast collagenase. Complete primary structure and homology to an oncogene transformation-induced rat protein. J Biol Chem. 1986 May 15;261(14):6600-5. 3009463
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Angel P, Baumann I, Stein B, Delius H, Rahmsdorf HJ, Herrlich P: 12-O-tetradecanoyl-phorbol-13-acetate induction of the human collagenase gene is mediated by an inducible enhancer element located in the 5'-flanking region. Mol Cell Biol. 1987 Jun;7(6):2256-66. 3037355
  6. Brinckerhoff CE, Ruby PL, Austin SD, Fini ME, White HD: Molecular cloning of human synovial cell collagenase and selection of a single gene from genomic DNA. J Clin Invest. 1987 Feb;79(2):542-6. 3027129
  7. Clark IM, Cawston TE: Fragments of human fibroblast collagenase. Purification and characterization. Biochem J. 1989 Oct 1;263(1):201-6. 2557822
  8. McKerrow JH: Human fibroblast collagenase contains an amino acid sequence homologous to the zinc-binding site of Serratia protease. J Biol Chem. 1987 May 5;262(13):5943. 3032950
  9. Desrochers PE, Jeffrey JJ, Weiss SJ: Interstitial collagenase (matrix metalloproteinase-1) expresses serpinase activity. J Clin Invest. 1991 Jun;87(6):2258-65. 1645757
  10. Saarinen J, Welgus HG, Flizar CA, Kalkkinen N, Helin J: N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. Eur J Biochem. 1999 Feb;259(3):829-40. 10092871
  11. Rumbaugh J, Turchan-Cholewo J, Galey D, St Hillaire C, Anderson C, Conant K, Nath A: Interaction of HIV Tat and matrix metalloproteinase in HIV neuropathogenesis: a new host defense mechanism. FASEB J. 2006 Aug;20(10):1736-8. Epub 2006 Jun 28. 16807369
  12. Bordoli MR, Yum J, Breitkopf SB, Thon JN, Italiano JE Jr, Xiao J, Worby C, Wong SK, Lin G, Edenius M, Keller TL, Asara JM, Dixon JE, Yeo CY, Whitman M: A secreted tyrosine kinase acts in the extracellular environment. Cell. 2014 Aug 28;158(5):1033-44. doi: 10.1016/j.cell.2014.06.048. 25171405
  13. Borkakoti N, Winkler FK, Williams DH, D'Arcy A, Broadhurst MJ, Brown PA, Johnson WH, Murray EJ: Structure of the catalytic domain of human fibroblast collagenase complexed with an inhibitor. Nat Struct Biol. 1994 Feb;1(2):106-10. 7656013
  14. Lovejoy B, Hassell AM, Luther MA, Weigl D, Jordan SR: Crystal structures of recombinant 19-kDa human fibroblast collagenase complexed to itself. Biochemistry. 1994 Jul 12;33(27):8207-17. 8031754
  15. Lovejoy B, Cleasby A, Hassell AM, Longley K, Luther MA, Weigl D, McGeehan G, McElroy AB, Drewry D, Lambert MH, et al.: Structure of the catalytic domain of fibroblast collagenase complexed with an inhibitor. Science. 1994 Jan 21;263(5145):375-7. 8278810
  16. Spurlino JC, Smallwood AM, Carlton DD, Banks TM, Vavra KJ, Johnson JS, Cook ER, Falvo J, Wahl RC, Pulvino TA, et al.: 1.56 A structure of mature truncated human fibroblast collagenase. Proteins. 1994 Jun;19(2):98-109. 8090713
  17. Moy FJ, Chanda PK, Cosmi S, Pisano MR, Urbano C, Wilhelm J, Powers R: High-resolution solution structure of the inhibitor-free catalytic fragment of human fibroblast collagenase determined by multidimensional NMR. Biochemistry. 1998 Feb 10;37(6):1495-504. 9484219