Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTubulin beta-4A chain
Synonyms
  • TUBB4
  • TUBB5
  • Tubulin 5 beta
  • Tubulin beta-4 chain
Gene NameTUBB4A
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010987|Tubulin beta-4A chain
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEGEFEEEAEEEVA
Number of residues444
Molecular Weight49585.475
Theoretical pI4.51
GO Classification
Functions
  • GTP binding
  • GTPase activity
  • structural constituent of cytoskeleton
Processes
  • 'de novo' posttranslational protein folding
  • cellular protein metabolic process
  • G2/M transition of mitotic cell cycle
  • microtubule-based process
  • mitotic cell cycle
  • organelle organization
  • protein folding
Components
  • microtubule
  • nucleus
  • neuronal cell body
  • cilium
  • internode region of axon
  • cytosol
  • extracellular exosome
  • myelin sheath
General FunctionStructural constituent of cytoskeleton
Specific FunctionTubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID35959
UniProtKB IDP04350
UniProtKB Entry NameTBB4A_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0010988|Tubulin beta-4A chain (TUBB4A)
ATGAGAAGGGGGGCTGCGGACCGAGAAACTGAGCGGCTCCCGGGGGCGCAGGGACCGTGC
TCCGCCGTCTCCGCCGCATCTTCCACCCTCGCCGCCGCCGCAGCTCCCCGCGCTCGTGCC
ACCGCCGCCGCGTCCACCCTCAGCGCCACCGCCATGCGGGAGATCGTGCACCTGCAGGCC
GGCCAGTGCGGCAACCAGATCGGGGCCAAGTTTTGGGAGGTTATCAGTGACGAACATGGC
ATCGACCCCACAGGCACATACCATGGGGACAGTGACCTGCAACTGGAGAGGATCAACGTG
TACTACAACGAGGCCACAGGAGGAAATTATGTCCCCAGAGCGGTGCTGGTGGACCTGGAA
CCCGGCACCATGGACTCTGTCCGTTCTGGCCCCTTCGGTCAGATCTTTCGGCCGGACAAC
TTCGTGTTTGGCCAATCCGGAGCCGGCAACAACTGGGCAAAGGGGCACTACACGGAGGGC
GCAGAGCTGGTGGACGCTGTCCTGGACGTAGTCCGGAAGGAGGCCGAGAGCTGCGACTGC
CTTCAGGGCTTCCAGCTGACCCACTCGCTGGGGGGTGGCACGGGGTCCGGAATGGGCACG
CTGCTCATCAGTAAGATCCGCGAGGAGTTCCCAGACCGCATCATGAACACCTTCAGCGTG
GTGCCCTCGCCCAAAGTGTCAGACACGGTGGTGGAGCCCTACAACGCCACGCTGTCTGTG
CACCAGCTGGTGGAGAATACGGATGAGACCTACTGCATCGACAACGAGGCACTCTACGAC
ATCTGTTTCCGCACCCTCAAGCTGACCACCCCCACCTACGGGGACCTCAACCACCTGGTG
TCGGCCACCATGAGCGGGGTCACCACCTGCCTGCGCTTCCCGGGCCAGCTGAACGCCGAC
CTGCGCAAGCTGGCCGTCAACATGGTTCCCTTTCCTCGCCTGCACTTCTTCATGCCCGGC
TTCGCACCCCTGACCAGCCGGGGCAGCCAGCAGTACCGGGCCCTGACGGTGCCCGAGCTC
ACCCAGCAGATGTTCGATGCCAAGAACATGATGGCGGCGTGCGACCCGCGCCACGGCCGC
TACCTGACCGTGGCCGCCGTGTTCCGGGGCCGCATGTCCATGAAGGAGGTGGACGAGCAG
ATGCTGAGCGTGCAGAGCAAGAACAGCAGCTACTTCGTGGAGTGGATCCCCAACAACGTG
AAGACGGCCGTGTGCGACATCCCGCCCCGCGGCCTGAAGATGGCCGCGACCTTCATCGGC
AACAGCACGGCCATCCAGGAGCTGTTCAAGCGCATCTCCGAGCAGTTCACGGCCATGTTC
CGGCGCAAGGCCTTCTTGCACTGGTACACGGGCGAGGGCATGGACGAGATGGAGTTCACC
GAGGCCGAGAGCAACATGAATGACCTGGTATCTGAGTACCAGCAGTACCAGGACGCCACG
GCCGAGGAGGGCGAGTTCGAGGAGGAGGCGGAGGAGGAGGTGGCCTAG
GenBank Gene IDX00734
GeneCard IDNot Available
GenAtlas IDTUBB4
HGNC IDHGNC:20774
Chromosome Location19
Locus19p13.3
References
  1. Lee MG, Loomis C, Cowan NJ: Sequence of an expressed human beta-tubulin gene containing ten Alu family members. Nucleic Acids Res. 1984 Jul 25;12(14):5823-36. 6462917
  2. Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. DNA Res. 2005;12(2):117-26. 16303743
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Baumann MH, Wisniewski T, Levy E, Plant GT, Ghiso J: C-terminal fragments of alpha- and beta-tubulin form amyloid fibrils in vitro and associate with amyloid deposits of familial cerebral amyloid angiopathy, British type. Biochem Biophys Res Commun. 1996 Feb 6;219(1):238-42. 8619814
  5. Rogowski K, Juge F, van Dijk J, Wloga D, Strub JM, Levilliers N, Thomas D, Bre MH, Van Dorsselaer A, Gaertig J, Janke C: Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation. Cell. 2009 Jun 12;137(6):1076-87. doi: 10.1016/j.cell.2009.05.020. 19524510
  6. Leandro-Garcia LJ, Leskela S, Landa I, Montero-Conde C, Lopez-Jimenez E, Leton R, Cascon A, Robledo M, Rodriguez-Antona C: Tumoral and tissue-specific expression of the major human beta-tubulin isotypes. Cytoskeleton (Hoboken). 2010 Apr;67(4):214-23. doi: 10.1002/cm.20436. 20191564
  7. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  8. Simons C, Wolf NI, McNeil N, Caldovic L, Devaney JM, Takanohashi A, Crawford J, Ru K, Grimmond SM, Miller D, Tonduti D, Schmidt JL, Chudnow RS, van Coster R, Lagae L, Kisler J, Sperner J, van der Knaap MS, Schiffmann R, Taft RJ, Vanderver A: A de novo mutation in the beta-tubulin gene TUBB4A results in the leukoencephalopathy hypomyelination with atrophy of the basal ganglia and cerebellum. Am J Hum Genet. 2013 May 2;92(5):767-73. doi: 10.1016/j.ajhg.2013.03.018. Epub 2013 Apr 11. 23582646
  9. Hersheson J, Mencacci NE, Davis M, MacDonald N, Trabzuni D, Ryten M, Pittman A, Paudel R, Kara E, Fawcett K, Plagnol V, Bhatia KP, Medlar AJ, Stanescu HC, Hardy J, Kleta R, Wood NW, Houlden H: Mutations in the autoregulatory domain of beta-tubulin 4a cause hereditary dystonia. Ann Neurol. 2013 Apr;73(4):546-53. doi: 10.1002/ana.23832. Epub 2013 Feb 19. 23424103