You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameProtamine-2
Synonyms
  • Sperm histone P2
  • Sperm protamine P2
Gene NamePRM2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008800|Protamine-2
MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSR
RRLHRIHRRQHRSCRRRKRRSCRHRRRHRRGCRTRKRTCRRH
Number of residues102
Molecular Weight13050.695
Theoretical pINot Available
GO Classification
Functions
  • DNA binding
Processes
  • DNA packaging
  • cell differentiation
  • multicellular organismal development
  • spermatogenesis
  • chromosome condensation
Components
  • nucleus
  • nucleoplasm
  • nucleosome
General FunctionDna binding
Specific FunctionProtamines substitute for histones in the chromatin of sperm during the haploid phase of spermatogenesis. They compact sperm DNA into a highly condensed, stable and inactive complex.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP04554
UniProtKB Entry NamePRM2_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0020823|Protamine-2 (PRM2)
ATGGTCCGATACCGCGTGAGGAGCCTGAGCGAACGCTCGCACGAGGTGTACAGGCAGCAG
TTGCATGGGCAAGAGCAAGGACACCACGGCCAAGAGGAGCAAGGGCTGAGCCCGGAGCAC
GTCGAGGTCTACGAGAGGACCCATGGCCAGTCTCACTATAGGCGCAGACACTGCTCTCGA
AGGAGGCTGCACCGGATCCACAGGCGGCAGCATCGCTCCTGCAGAAGGCGCAAAAGACGC
TCCTGCAGGCACCGGAGGAGGCATCGCAGAGAGTCCCTAGGTGACCCCCTCAACCAGAAC
TTTCTTTCCCAAAAGGCTGCAGAACCAGGAAGAGAACATGCAGAAGGCACTAAGCTTCCT
GGGCCCCTCACCCCCAGCTGGAAATTAAGAAAAAGTCGCCCGAAACACCAAGTGAGGCCA
TAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9448
Chromosome Location16
LocusNot Available
References
  1. Domenjoud L, Fronia C, Uhde F, Engel W: Sequence of human protamine 2 cDNA. Nucleic Acids Res. 1988 Aug 11;16(15):7733. 3412906
  2. Domenjoud L, Nussbaum G, Adham IM, Greeske G, Engel W: Genomic sequences of human protamines whose genes, PRM1 and PRM2, are clustered. Genomics. 1990 Sep;8(1):127-33. 2081589
  3. Nelson JE, Krawetz SA: Characterization of a human locus in transition. J Biol Chem. 1994 Dec 9;269(49):31067-73. 7983046
  4. Wyckoff GJ, Wang W, Wu CI: Rapid evolution of male reproductive genes in the descent of man. Nature. 2000 Jan 20;403(6767):304-9. 10659848
  5. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  6. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. 15616553
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  8. Martinage A, Arkhis A, Alimi E, Sautiere P, Chevaillier P: Molecular characterization of nuclear basic protein HPI1, a putative precursor of human sperm protamines HP2 and HP3. Eur J Biochem. 1990 Jul 31;191(2):449-51. 2384091
  9. Alimi E, Martinage A, Arkhis A, Belaiche D, Sautiere P, Chevaillier P: Amino acid sequence of the human intermediate basic protein 2 (HPI2) from sperm nuclei. Structural relationship with protamine P2. Eur J Biochem. 1993 Jun 1;214(2):445-50. 8513794
  10. Sautiere P, Martinage A, Belaiche D, Arkhis A, Chevaillier P: Comparison of the amino acid sequences of human protamines HP2 and HP3 and of intermediate basic nuclear proteins HPS1 and HPS2. Structural evidence that HPS1 and HPS2 are pro-protamines. J Biol Chem. 1988 Aug 15;263(23):11059-62. 3403514
  11. Ammer H, Henschen A, Lee CH: Isolation and amino-acid sequence analysis of human sperm protamines P1 and P2. Occurrence of two forms of protamine P2. Biol Chem Hoppe Seyler. 1986 Jun;367(6):515-22. 3527226
  12. McKay DJ, Renaux BS, Dixon GH: Human sperm protamines. Amino-acid sequences of two forms of protamine P2. Eur J Biochem. 1986 Apr 1;156(1):5-8. 3956509
  13. Arkhis A, Martinage A, Sautiere P, Chevaillier P: Molecular structure of human protamine P4 (HP4), a minor basic protein of human sperm nuclei. Eur J Biochem. 1991 Sep 1;200(2):387-92. 1889406