You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameCarbonic anhydrase 3
Synonyms
  • 4.2.1.1
  • CA-III
  • Carbonate dehydratase III
  • Carbonic anhydrase III
Gene NameCA3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0012519|Carbonic anhydrase 3
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
Number of residues260
Molecular Weight29557.215
Theoretical pI7.38
GO Classification
Functions
  • nickel cation binding
  • phosphatase activity
  • zinc ion binding
  • carbonate dehydratase activity
Processes
  • response to oxidative stress
  • small molecule metabolic process
  • response to ethanol
  • bicarbonate transport
  • one-carbon metabolic process
Components
  • cytosol
General FunctionZinc ion binding
Specific FunctionReversible hydration of carbon dioxide.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID189053812
UniProtKB IDP07451
UniProtKB Entry NameCAH3_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0012520|Carbonic anhydrase 3 (CA3)
ATGGCCAAGGAGTGGGGCTACGCCAGTCACAACGGTCCTGACCACTGGCATGAACTTTTC
CCAAATGCCAAGGGGGAAAACCAGTCGCCCGTTGAGCTGCATACTAAAGACATCAGGCAT
GACCCTTCTCTGCAGCCATGGTCTGTGTCTTATGATGGTGGCTCTGCCAAGACCATCCTG
AATAATGGGAAGACCTGCCGAGTTGTATTTGATGATACTTATGATAGGTCAATGCTGAGA
GGGGGTCCTCTCCCTGGACCCTACCGACTTCGCCAGTTTCATCTTCACTGGGGCTCTTCG
GATGATCATGGCTCTGAGCACACCGTGGATGGAGTCAAGTATGCAGCGGAGCTTCATTTG
GTTCACTGGAACCCGAAGTATAACACTTTTAAAGAAGCCCTGAAGCAGCGCGATGGGATC
GCTGTGATTGGCATTTTTCTGAAGATAGGACATGAGAATGGCGAGTTCCAGATTTTCCTT
GATGCATTGGACAAGATTAAGACAAAGGGCAAGGAGGCGCCCTTCACAAAGTTTGACCCA
TCCTGCCTGTTCCCGGCATGCCGGGACTACTGGACCTACCAGGGCTCATTCACCACGCCG
CCCTGCGAGGAATGCATTGTGTGGCTGCTGCTGAAGGAGCCCATGACCGTGAGCTCTGAC
CAGATGGCCAAGCTGCGGAGCCTCCTCTCCAGTGCTGAGAACGAGCCCCCAGTGCCTCTT
GTGAGCAACTGGCGACCTCCACAGCCTATCAATAACAGGGTGGTGAGAGCTTCCTTCAAA
TGA
GenBank Gene IDAK313254
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:1374
Chromosome Location8
Locus8q13-q22
References
  1. Lloyd J, McMillan S, Hopkinson D, Edwards YH: Nucleotide sequence and derived amino acid sequence of a cDNA encoding human muscle carbonic anhydrase. Gene. 1986;41(2-3):233-9. 3086182
  2. Wade R, Gunning P, Eddy R, Shows T, Kedes L: Nucleotide sequence, tissue-specific expression, and chromosome location of human carbonic anhydrase III: the human CAIII gene is located on the same chromosome as the closely linked CAI and CAII genes. Proc Natl Acad Sci U S A. 1986 Dec;83(24):9571-5. 3099285
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Lloyd J, Brownson C, Tweedie S, Charlton J, Edwards YH: Human muscle carbonic anhydrase: gene structure and DNA methylation patterns in fetal and adult tissues. Genes Dev. 1987 Aug;1(6):594-602. 2824285
  6. Sowden J, Smith H, Morrison K, Edwards Y: Sequence comparisons and functional studies of the proximal promoter of the carbonic anhydrase 3 (CA3) gene. Gene. 1998 Jul 3;214(1-2):157-65. 9651514
  7. Crocetti L, Maresca A, Temperini C, Hall RA, Scozzafava A, Muhlschlegel FA, Supuran CT: A thiabendazole sulfonamide shows potent inhibitory activity against mammalian and nematode alpha-carbonic anhydrases. Bioorg Med Chem Lett. 2009 Mar 1;19(5):1371-5. doi: 10.1016/j.bmcl.2009.01.038. Epub 2009 Jan 19. 19186056
  8. Maresca A, Temperini C, Vu H, Pham NB, Poulsen SA, Scozzafava A, Quinn RJ, Supuran CT: Non-zinc mediated inhibition of carbonic anhydrases: coumarins are a new class of suicide inhibitors. J Am Chem Soc. 2009 Mar 4;131(8):3057-62. doi: 10.1021/ja809683v. 19206230
  9. Di Fiore A, Monti SM, Hilvo M, Parkkila S, Romano V, Scaloni A, Pedone C, Scozzafava A, Supuran CT, De Simone G: Crystal structure of human carbonic anhydrase XIII and its complex with the inhibitor acetazolamide. Proteins. 2009 Jan;74(1):164-75. doi: 10.1002/prot.22144. 18618712
  10. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  11. Duda DM, Tu C, Fisher SZ, An H, Yoshioka C, Govindasamy L, Laipis PJ, Agbandje-McKenna M, Silverman DN, McKenna R: Human carbonic anhydrase III: structural and kinetic study of catalysis and proton transfer. Biochemistry. 2005 Aug 2;44(30):10046-53. 16042381
  12. Elder I, Fisher Z, Laipis PJ, Tu C, McKenna R, Silverman DN: Structural and kinetic analysis of proton shuttle residues in the active site of human carbonic anhydrase III. Proteins. 2007 Jul 1;68(1):337-43. 17427958