You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMuscarinic acetylcholine receptor M5
SynonymsNot Available
Gene NameCHRM5
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010217|Muscarinic acetylcholine receptor M5
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPL
DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAE
KRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQL
TTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPN
YLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP
NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG
YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
Number of residues532
Molecular Weight60073.205
Theoretical pI9.64
GO Classification
Functions
  • G-protein coupled acetylcholine receptor activity
  • phosphatidylinositol phospholipase C activity
Processes
  • adenylate cyclase-inhibiting G-protein coupled acetylcholine receptor signaling pathway
  • G-protein coupled acetylcholine receptor signaling pathway
  • phospholipase C-activating G-protein coupled acetylcholine receptor signaling pathway
  • sensory perception of chemical stimulus
  • synaptic transmission, cholinergic
  • dopamine transport
  • gastric acid secretion
  • regulation of phosphatidylinositol dephosphorylation
  • transmission of nerve impulse
  • cell proliferation
Components
  • synapse
  • postsynaptic membrane
  • plasma membrane
  • cell junction
  • integral component of plasma membrane
General FunctionPhosphatidylinositol phospholipase c activity
Specific FunctionThe muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Pfam Domain Function
Transmembrane Regions30-53 67-87 105-126 147-169 192-214 444-464 479-498
GenBank Protein ID177988
UniProtKB IDP08912
UniProtKB Entry NameACM5_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010218|Muscarinic acetylcholine receptor M5 (CHRM5)
ATGGAAGGGGATTCTTACCACAATGCAACCACCGTCAATGGCACCCCAGTAAATCACCAG
CCTTTGGAACGCCACAGGTTGTGGGAAGTCATCACCATTGCAGCTGTGACTGCTGTGGTA
AGCCTGATCACCATTGTGGGCAATGTCTTGGTCATGATCTCCTTCAAAGTCAACAGCCAG
CTCAAGACAGTTAACAACTATTACCTGCTCAGCTTAGCCTGTGCAGATCTCATCATTGGA
ATCTTCTCCATGAACCTCTACACCACCTACATCCTCATGGGACGCTGGGCTCTCGGGAGT
CTGGCTTGTGACCTTTGGCTTGCACTGGACTACGTGGCCAGCAACGCTTCTGTCATGAAC
CTTCTGGTGATCAGTTTTGACCGTTACTTTTCCATCACAAGACCCTTGACATATCGGGCC
AAGCGTACTCCGAAAAGGGCTGGCATCATGATTGGCTTGGCCTGGCTGATCTCCTTCATC
CTCTGGGCCCCAGCAATCCTCTGCTGGCAGTACTTGGTTGGGAAGCGGACAGTTCCACTG
GATGAGTGCCAGATCCAGTTTCTCTCTGAGCCCACCATCACTTTTGGCACTGCCATTGCT
GCCTTCTACATCCCTGTTTCTGTCATGACCATCCTCTACTGTCGAATCTACCGGGAAACA
GAGAAGCGAACCAAGGACCTGGCTGACCTCCAGGGTTCTGACTCTGTGACCAAAGCTGAG
AAGAGAAAGCCAGCTCATAGGGCTCTGTTCAGATCCTGCTTGCGCTGTCCTCGACCCACC
CTGGCCCAGCGGGAAAGGAACCAGGCCTCCTGGTCATCCTCCCGCAGGAGCACCTCCACC
ACTGGGAAGCCATCCCAAGCCACTGGCCCAAGCGCCAATTGGGCCAAAGCTGAGCAGCTC
ACCACCTGTAGCAGCTACCCTTCCTCAGAGGATGAGGACAAGCCCGCCACTGACCCTGTC
CTCCAAGTGGTCTACAAGAGTCAGGGTAAGGAAAGCCCAGGGGAAGAATTCAGTGCTGAA
GAGACTGAGGAAACTTTTGTGAAAGCTGAAACTGAAAAAAGTGACTATGACACCCCAAAC
TACCTTCTGTCTCCAGCAGCTGCTCATAGACCCAAGAGTCAGAAATGTGTGGCCTATAAG
TTCCGATTGGTGGTAAAAGCTGACGGGAACCAGGAGACCAACAATGGCTGTCACAAGGTG
AAAATCATGCCCTGCCCCTTCCCAGTGGCCAAGGAACCTTCAACGAAAGGCCTCAATCCC
AACCCCAGCCATCAAATGACCAAACGAAAGAGAGTGGTCCTAGTCAAAGAGAGGAAAGCA
GCCCAGACACTGAGTGCCATTCTCCTGGCCTTCATCATCACATGGACCCCGTATAACATC
ATGGTCCTGGTTTCTACCTTCTGTGACAAGTGTGTCCCAGTCACCCTGTGGCACTTGGGC
TATTGGTTGTGCTATGTCAATAGCACTGTCAACCCCATCTGCTATGCCCTCTGCAACAGA
ACCTTCAGGAAGACCTTTAAGATGCTGCTTCTCTGCCGATGGAAAAAGAAAAAAGTGGAA
GAGAAGTTGTACTGGCAGGGGAACAGCAAGCTACCCTGA
GenBank Gene IDM80333
GeneCard IDNot Available
GenAtlas IDCHRM5
HGNC IDHGNC:1954
Chromosome Location15
Locus15q26
References
  1. Bonner TI, Young AC, Brann MR, Buckley NJ: Cloning and expression of the human and rat m5 muscarinic acetylcholine receptor genes. Neuron. 1988 Jul;1(5):403-10. 3272174