You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameDopamine beta-hydroxylase
Synonyms
  • 1.14.17.1
  • Dopamine beta-monooxygenase
Gene NameDBH
OrganismHuman
Amino acid sequence
>lcl|BSEQ0036959|Dopamine beta-hydroxylase
MPALSRWASLPGPSMREAAFMYSTAVAIFLVILVAALQGSAPRESPLPYHIPLDPEGSLE
LSWNVSYTQEAIHFQLLVRRLKAGVLFGMSDRGELENADLVVLWTDGDTAYFADAWSDQK
GQIHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSL
EAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKG
FSRHHIIKYEPIVTKGNEALVHHMEVFQCAPEMDSVPHFSGPCDSKMKPDRLNYCRHVLA
AWALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVIEGRNDSSGIRLYYTAKLRRF
NAGIMELGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKV
VTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGG
FGILEEMCVNYVHYYPQTQLELCKSAVDAGFLQKYFHLINRFNNEDVCTCPQASVSQQFT
SVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ
GRSPAGPTVVSIGGGKG
Number of residues617
Molecular Weight69064.45
Theoretical pI6.31
GO Classification
Functions
  • L-ascorbic acid binding
  • catalytic activity
  • copper ion binding
  • dopamine beta-monooxygenase activity
Processes
  • cytokine production
  • glucose homeostasis
  • regulation of cell proliferation
  • leukocyte migration
  • catecholamine biosynthetic process
  • locomotory behavior
  • homoiothermy
  • response to amphetamine
  • maternal behavior
  • leukocyte mediated immunity
  • positive regulation of vasoconstriction
  • norepinephrine biosynthetic process
  • memory
  • regulation of extrinsic apoptotic signaling pathway
  • response to pain
  • visual learning
  • fear response
  • blood vessel remodeling
  • synaptic transmission
  • behavioral response to ethanol
  • cellular nitrogen compound metabolic process
  • dopamine catabolic process
  • small molecule metabolic process
Components
  • secretory granule lumen
  • chromaffin granule membrane
  • chromaffin granule lumen
  • cytoplasm
  • membrane
  • extracellular region
  • integral component of membrane
  • transport vesicle membrane
General FunctionL-ascorbic acid binding
Specific FunctionConversion of dopamine to noradrenaline.
Pfam Domain Function
Transmembrane Regions17-37
GenBank Protein ID30474
UniProtKB IDP09172
UniProtKB Entry NameDOPO_HUMAN
Cellular LocationCytoplasmic vesicle
Gene sequence
>lcl|BSEQ0016020|Dopamine beta-hydroxylase (DBH)
ATGCCCGCCCTCAGTCGCTGGGCCAGCCTGCCCGGCCCCAGCATGCGGGAGGCAGCCTTC
ATGTACAGCACAGCAGTGGCCATCTTCCTGGTCATCCTGGTGGCCGCACTGCAGGGCTCG
GCTCCCCGTGAGAGCCCCCTCCCCTATCACATCCCCCTGGACCCGGAGGGGTCCCTGGAG
CTCTCATGGAATGTCAGCTACACCCAGGAGGCCATCCATTTCCAGCTCCTGGTGCGGAGG
CTCAAGGCTGGCGTCCTGTTTGGGATGTCCGACCGTGGCGAGCTTGAGAACGCAGATCTC
GTGGTGCTCTGGACCGATGGGGACACTGCCTATTTTGCGGACGCCTGGAGTGACCAGAAG
GGGCAGATCCACCTGGATCCCCAGCAGGACTACCAGCTGCTGCAGGTGCAGAGGACCCCA
GAAGGCCTGACCCTGCTTTTCAAGAGGCCCTTTGGCACCTGCGACCCCAAGGATTACCTC
ATTGAAGACGGCACTGTCCACTTGGTCTACGGGATCCTGGAGGAGCCGTTCCGGTCACTG
GAGGCCATCAACGGCTCGGGCCTGCAGATGGGGCTGCAGAGGGTGCAGCTCCTGAAGCCC
AATATCCCCGAACCGGAGTTGCCCTCAGACGCGTGCACCATGGAGGTCCAAGCTCCCAAT
ATCCAGATCCCCAGCCAGGAGACCACGTACTGGTGCTACATTAAGGAGCTTCCAAAGGGC
TTCTCTCGGCACCACATTATCAAGTACGAGCCCATCGTCACCAAGGGCAATGAGGCCCTT
GTCCACCACATGGAAGTCTTCCAGTGCGCCCCCGAGATGGACAGCGTCCCCCACTTCAGC
GGGCCCTGCGACTCCAAGATGAAACCCGACCGCCTCAACTACTGCCGCCACGTGCTGGCC
GCCTGGGCCCTGGGTGCCAAGGCATTTTACTACCCAGAGGAAGCCGGCCTTGCCTTCGGG
GGTCCAGGGTCCTCCAGATATCTCCGCCTGGAAGTTCACTACCACAACCCACTGGTGATA
GAAGGACGAAACGACTCCTCAGGCATCCGCTTGTACTACACAGCCAAGCTGCGGCGCTTC
AACGCGGGGATCATGGAGCTGGGACTGGTGTACACGCCAGTGATGGCCATTCCACCACGG
GAGACCGCCTTCATCCTCACTGGCTACTGCACGGACAAGTGCACCCAGCTGGCACTGCCT
CCCTCCGGGATCCACATCTTCGCCTCTCAGCTCCACACACACCTGACTGGGAGAAAGGTG
GTCACAGTGCTGGTCCGGGACGGCCGGGAGTGGGAGATCGTGAACCAGGACAATCACTAC
AGCCCTCACTTCCAGGAGATCCGCATGTTGAAGAAGGTCGTGTCGGTCCATCCGGGAGAT
GTGCTCATCACCTCCTGCACGTACAACACAGAAGACCGGGAGCTGGCCACAGTGGGGGGC
TTCGGGATCCTGGAGGAGATGTGTGTCAACTACGTGCACTACTACCCCCAGACGCAGCTG
GAGCTCTGCAAGAGCGCTGTGGACGCCGGCTTCCTGCAGAAGTACTTCCACCTCATCAAC
AGGTTCAACAACGAGGATGTCTGCACCTGCCCTCAGGCGTCCGTGTCTCAGCAGTTCACC
TCTGTTCCCTGGAACTCCTTCAACCGCGACGTACTGAAGGCCCTGTACAGCTTCGCGCCC
ATCTCCATGCACTGCAACAAGTCCTCAGCCGTCCGCTTCCAGGGTGAATGGAACCTGCAG
CCCCTGCCCAAGGTCATCTCCACACTGGAAGAGCCCACCCCACAGTGCCCCACCAGCCAG
GGCCGAAGCCCTGCTGGCCCCACCGTTGTCAGCATTGGTGGGGGCAAAGGCTGA
GenBank Gene IDX13255
GeneCard IDNot Available
GenAtlas IDDBH
HGNC IDHGNC:2689
Chromosome Location9
Locus9q34
References
  1. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. 15164053
  2. Lamouroux A, Vigny A, Faucon Biguet N, Darmon MC, Franck R, Henry JP, Mallet J: The primary structure of human dopamine-beta-hydroxylase: insights into the relationship between the soluble and the membrane-bound forms of the enzyme. EMBO J. 1987 Dec 20;6(13):3931-7. 3443096
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Kobayashi K, Kurosawa Y, Fujita K, Nagatsu T: Human dopamine beta-hydroxylase gene: two mRNA types having different 3'-terminal regions are produced through alternative polyadenylation. Nucleic Acids Res. 1989 Feb 11;17(3):1089-102. 2922261
  5. Li B, Tsing S, Kosaka AH, Nguyen B, Osen EG, Bach C, Chan H, Barnett J: Expression of human dopamine beta-hydroxylase in Drosophila Schneider 2 cells. Biochem J. 1996 Jan 1;313 ( Pt 1):57-64. 8546710
  6. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. 16335952
  7. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. 19139490
  8. Williams HJ, Bray N, Murphy KC, Cardno AG, Jones LA, Owen MJ: No evidence for allelic association between schizophrenia and a functional variant of the human dopamine beta-hydroxylase gene (DBH). Am J Med Genet. 1999 Oct 15;88(5):557-9. 10490716
  9. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. 10391209
  10. Halushka MK, Fan JB, Bentley K, Hsie L, Shen N, Weder A, Cooper R, Lipshutz R, Chakravarti A: Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis. Nat Genet. 1999 Jul;22(3):239-47. 10391210
  11. Kim CH, Zabetian CP, Cubells JF, Cho S, Biaggioni I, Cohen BM, Robertson D, Kim KS: Mutations in the dopamine beta-hydroxylase gene are associated with human norepinephrine deficiency. Am J Med Genet. 2002 Mar 1;108(2):140-7. 11857564