DNA-directed RNA polymerase subunit alpha

NameDNA-directed RNA polymerase subunit alpha
Synonyms
  • 2.7.7.6
  • pez
  • phs
  • RNA polymerase subunit alpha
  • RNAP subunit alpha
  • sez
  • Transcriptase subunit alpha
Gene NamerpoA
OrganismEscherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0016098|DNA-directed RNA polymerase subunit alpha
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE
Number of residues329
Molecular Weight36511.35
Theoretical pI4.7
GO Classification
Functions
  • zinc ion binding
  • DNA binding
  • DNA-directed RNA polymerase activity
Processes
  • transcription, DNA-templated
Components
  • cytoplasm
  • membrane
  • cytosol
General FunctionZinc ion binding
Specific FunctionDNA-dependent RNA polymerase (RNAP) catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. This subunit plays an important role in subunit assembly since its dimerization is the first step in the sequential assembly of subunits to form the holoenzyme.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID147715
UniProtKB IDP0A7Z4
UniProtKB Entry NameRPOA_ECOLI
Cellular LocationCytoplasmic
Gene sequence
>lcl|BSEQ0016099|DNA-directed RNA polymerase subunit alpha (rpoA)
ATGCAGGGTTCTGTGACAGAGTTTCTAAAACCGCGCCTGGTTGATATCGAGCAAGTGAGT
TCGACGCACGCCAAGGTGACCCTTGAGCCTTTAGAGCGTGGCTTTGGCCATACTCTGGGT
AACGCACTGCGCCGTATTCTGCTCTCATCGATGCCGGGTTGCGCGGTGACCGAGGTTGAG
ATTGATGGTGTACTACATGAGTACAGCACCAAAGAAGGCGTTCAGGAAGATATCCTGGAA
ATCCTGCTCAACCTGAAAGGGCTGGCGGTGAGAGTTCAGGGCAAAGATGAAGTTATTCTT
ACCTTGAATAAATCTGGCATTGGCCCTGTGACTGCAGCCGATATCACCCACGACGGTGAT
GTCGAAATCGTCAAGCCGCAGCACGTGATCTGCCACCTGACCGATGAGAACGCGTCTATT
AGCATGCGTATCAAAGTTCAGCGCGGTCGTGGTTATGTGCCGGCTTCTACCCGAATTCAT
TCGGAAGAAGATGAGCGCCCAATCGGCCGTCTGCTGGTCGACGCATGCTACAGCCCTGTG
GAGCGTATTGCCTACAATGTTGAAGCAGCGCGTGTAGAACAGCGTACCGACCTGGACAAG
CTGGTCATCGAAATGGAAACCAACGGCACAATCGATCCTGAAGAGGCGATTCGTCGTGCG
GCAACCATTCTGGCTGAACAACTGGAAGCTTTCGTTGACTTACGTGATGTACGTCAGCCT
GAAGTGAAAGAAGAGAAACCAGAGTTCGATCCGATCCTGCTGCGCCCTGTTGACGATCTG
GAATTGACTGTCCGCTCTGCTAACTGCCTTAAAGCAGAAGCTATCCACTATATCGGTGAT
CTGGTACAGCGTACCGAGGTTGAGCTCCTTAAAACGCCTAACCTTGGTAAAAAATCTCTT
ACTGAGATTAAAGACGTGCTGGCTTCCCGTGGACTGTCTCTGGGCATGCGCCTGGAAAAC
TGGCCACCGGCAAGCATCGCTGACGAGTAA
GenBank Gene IDJ01685
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDNot Available
Chromosome LocationNot Available
LocusNot Available
References
  1. Ovchinnikov YA, Lipkin VM, Modyanov NN, Chertov OY, Smirnov YV: Primary structure of alpha-subunit of DNA-dependent RNA polymerase from Escherichia coli. FEBS Lett. 1977 Apr 1;76(1):108-11. 323055
  2. Meek DW, Hayward RS: Nucleotide sequence of the rpoA-rplQ DNA of Escherichia coli: a second regulatory binding site for protein S4? Nucleic Acids Res. 1984 Jul 25;12(14):5813-21. 6379605
  3. Bedwell D, Davis G, Gosink M, Post L, Nomura M, Kestler H, Zengel JM, Lindahl L: Nucleotide sequence of the alpha ribosomal protein operon of Escherichia coli. Nucleic Acids Res. 1985 Jun 11;13(11):3891-903. 2989779
  4. Igarashi K, Fujita N, Ishihama A: Sequence analysis of two temperature-sensitive mutations in the alpha subunit gene (rpoA) of Escherichia coli RNA polymerase. Nucleic Acids Res. 1990 Oct 25;18(20):5945-8. 2235479
  5. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. 9278503
  6. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. 16738553
  7. Post LE, Nomura M: Nucleotide sequence of the intercistronic region preceding the gene for RNA polymerase subunit alpha in Escherichia coli. J Biol Chem. 1979 Nov 10;254(21):10604-6. 387752
  8. Link AJ, Robison K, Church GM: Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12. Electrophoresis. 1997 Aug;18(8):1259-313. 9298646
  9. Schnier J, Isono S, Cumberlidge AG, Isono K: Unstable mutations caused by regional tandem multiplications in the gene for ribosomal protein S4 show thermosensitivity in Escherichia coli. Mol Gen Genet. 1985;199(2):265-70. 3894886
  10. Fujiki H, Zurek G: The subunits of DNA-dependent RNA polymerase from E. coli: I. Amino acid analysis and primary structure of the N-terminal regions. FEBS Lett. 1975 Jul 15;55(1):242-4. 1095419
  11. VanBogelen RA, Abshire KZ, Moldover B, Olson ER, Neidhardt FC: Escherichia coli proteome analysis using the gene-protein database. Electrophoresis. 1997 Aug;18(8):1243-51. 9298644
  12. Igarashi K, Ishihama A: Bipartite functional map of the E. coli RNA polymerase alpha subunit: involvement of the C-terminal region in transcription activation by cAMP-CRP. Cell. 1991 Jun 14;65(6):1015-22. 1646077
  13. Niu W, Kim Y, Tau G, Heyduk T, Ebright RH: Transcription activation at class II CAP-dependent promoters: two interactions between CAP and RNA polymerase. Cell. 1996 Dec 13;87(6):1123-34. 8978616
  14. Lima BP, Antelmann H, Gronau K, Chi BK, Becher D, Brinsmade SR, Wolfe AJ: Involvement of protein acetylation in glucose-induced transcription of a stress-responsive promoter. Mol Microbiol. 2011 Sep;81(5):1190-204. doi: 10.1111/j.1365-2958.2011.07742.x. Epub 2011 Jul 28. 21696463
  15. Jeon YH, Negishi T, Shirakawa M, Yamazaki T, Fujita N, Ishihama A, Kyogoku Y: Solution structure of the activator contact domain of the RNA polymerase alpha subunit. Science. 1995 Dec 1;270(5241):1495-7. 7491496
  16. Zhang G, Darst SA: Structure of the Escherichia coli RNA polymerase alpha subunit amino-terminal domain. Science. 1998 Jul 10;281(5374):262-6. 9657722
  17. Benoff B, Yang H, Lawson CL, Parkinson G, Liu J, Blatter E, Ebright YW, Berman HM, Ebright RH: Structural basis of transcription activation: the CAP-alpha CTD-DNA complex. Science. 2002 Aug 30;297(5586):1562-6. 12202833
  18. Hudson BP, Quispe J, Lara-Gonzalez S, Kim Y, Berman HM, Arnold E, Ebright RH, Lawson CL: Three-dimensional EM structure of an intact activator-dependent transcription initiation complex. Proc Natl Acad Sci U S A. 2009 Nov 24;106(47):19830-5. doi: 10.1073/pnas.0908782106. Epub 2009 Nov 10. 19903881