You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameEarly growth response protein 1
Synonyms
  • AT225
  • EGR-1
  • KROX24
  • Nerve growth factor-induced protein A
  • NGFI-A
  • Transcription factor ETR103
  • Transcription factor Zif268
  • Zinc finger protein 225
  • Zinc finger protein Krox-24
  • ZNF225
Gene NameEGR1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0021442|Early growth response protein 1
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS
NSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETS
YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAAS
SASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAY
PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR
IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSS
TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTI
EIC
Number of residues543
Molecular Weight57506.17
Theoretical pINot Available
GO Classification
Functions
  • transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
  • histone acetyltransferase binding
  • DNA binding
  • metal ion binding
  • sequence-specific DNA binding
  • transcription regulatory region sequence-specific DNA binding
  • transcription factor activity, sequence-specific DNA binding
  • RNA polymerase II core promoter sequence-specific DNA binding
  • RNA polymerase II regulatory region sequence-specific DNA binding
Processes
  • learning or memory
  • response to amphetamine
  • cellular response to gamma radiation
  • long-term synaptic potentiation
  • circadian rhythm
  • skeletal muscle cell differentiation
  • negative regulation of canonical Wnt signaling pathway
  • response to nutrient levels
  • T cell differentiation
  • oligodendrocyte differentiation
  • negative regulation of transcription from RNA polymerase II promoter
  • cellular response to hyperoxia
  • cellular response to insulin stimulus
  • cellular response to antibiotic
  • cytokine-mediated signaling pathway
  • cellular response to heparin
  • positive regulation of neuron apoptotic process
  • response to cocaine
  • cellular response to isoquinoline alkaloid
  • interleukin-1-mediated signaling pathway
  • cellular response to drug
  • glomerular mesangial cell proliferation
  • regulation of transcription from RNA polymerase II promoter in response to hypoxia
  • BMP signaling pathway
  • positive regulation of glomerular metanephric mesangial cell proliferation
  • cellular response to follicle-stimulating hormone stimulus
  • response to ethanol
  • regulation of protein sumoylation
  • response to norepinephrine
  • transcription from RNA polymerase II promoter
  • cellular response to mycophenolic acid
  • response to electrical stimulus
  • regulation of long-term neuronal synaptic plasticity
  • type I interferon signaling pathway
  • cellular response to mechanical stimulus
  • response to glucose
  • positive regulation of transcription, DNA-templated
  • cellular response to steroid hormone stimulus
  • cellular response to cAMP
  • positive regulation of transcription from RNA polymerase II promoter
  • response to carbon monoxide
Components
  • cytoplasm
  • nucleus
  • nucleoplasm
General FunctionTranscriptional activator activity, rna polymerase ii core promoter proximal region sequence-specific binding
Specific FunctionTranscriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP18146
UniProtKB Entry NameEGR1_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0021443|Early growth response protein 1 (EGR1)
ATGGCCGCGGCCAAGGCCGAGATGCAGCTGATGTCCCCGCTGCAGATCTCTGACCCGTTC
GGATCCTTTCCTCACTCGCCCACCATGGACAACTACCCTAAGCTGGAGGAGATGATGCTG
CTGAGCAACGGGGCTCCCCAGTTCCTCGGCGCCGCCGGGGCCCCAGAGGGCAGCGGCAGC
AACAGCAGCAGCAGCAGCAGCGGGGGCGGTGGAGGCGGCGGGGGCGGCAGCAACAGCAGC
AGCAGCAGCAGCACCTTCAACCCTCAGGCGGACACGGGCGAGCAGCCCTACGAGCACCTG
ACCGCAGAGTCTTTTCCTGACATCTCTCTGAACAACGAGAAGGTGCTGGTGGAGACCAGT
TACCCCAGCCAAACCACTCGACTGCCCCCCATCACCTATACTGGCCGCTTTTCCCTGGAG
CCTGCACCCAACAGTGGCAACACCTTGTGGCCCGAGCCCCTCTTCAGCTTGGTCAGTGGC
CTAGTGAGCATGACCAACCCACCGGCCTCCTCGTCCTCAGCACCATCTCCAGCGGCCTCC
TCCGCCTCCGCCTCCCAGAGCCCACCCCTGAGCTGCGCAGTGCCATCCAACGACAGCAGT
CCCATTTACTCAGCGGCACCCACCTTCCCCACGCCGAACACTGACATTTTCCCTGAGCCA
CAAAGCCAGGCCTTCCCGGGCTCGGCAGGGACAGCGCTCCAGTACCCGCCTCCTGCCTAC
CCTGCCGCCAAGGGTGGCTTCCAGGTTCCCATGATCCCCGACTACCTGTTTCCACAGCAG
CAGGGGGATCTGGGCCTGGGCACCCCAGACCAGAAGCCCTTCCAGGGCCTGGAGAGCCGC
ACCCAGCAGCCTTCGCTAACCCCTCTGTCTACTATTAAGGCCTTTGCCACTCAGTCGGGC
TCCCAGGACCTGAAGGCCCTCAATACCAGCTACCAGTCCCAGCTCATCAAACCCAGCCGC
ATGCGCAAGTACCCCAACCGGCCCAGCAAGACGCCCCCCCACGAACGCCCTTACGCTTGC
CCAGTGGAGTCCTGTGATCGCCGCTTCTCCCGCTCCGACGAGCTCACCCGCCACATCCGC
ATCCACACAGGCCAGAAGCCCTTCCAGTGCCGCATCTGCATGCGCAACTTCAGCCGCAGC
GACCACCTCACCACCCACATCCGCACCCACACAGGCGAAAAGCCCTTCGCCTGCGACATC
TGTGGAAGAAAGTTTGCCAGGAGCGATGAACGCAAGAGGCATACCAAGATCCACTTGCGG
CAGAAGGACAAGAAAGCAGACAAAAGTGTTGTGGCCTCTTCGGCCACCTCCTCTCTCTCT
TCCTACCCGTCCCCGGTTGCTACCTCTTACCCGTCCCCGGTTACTACCTCTTATCCATCC
CCGGCCACCACCTCATACCCATCCCCTGTGCCCACCTCCTTCTCCTCTCCCGGCTCCTCG
ACCTACCCATCCCCTGTGCACAGTGGCTTCCCCTCCCCGTCGGTGGCCACCACGTACTCC
TCTGTTCCCCCTGCTTTCCCGGCCCAGGTCAGCAGCTTCCCTTCCTCAGCTGTCACCAAC
TCCTTCAGCGCCTCCACAGGGCTTTCGGACATGACAGCAACCTTTTCTCCCAGGACAATT
GAAATTTGCTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:3238
Chromosome Location5
LocusNot Available
References
  1. Suggs SV, Katzowitz JL, Tsai-Morris C, Sukhatme VP: cDNA sequence of the human cellular early growth response gene Egr-1. Nucleic Acids Res. 1990 Jul 25;18(14):4283. 2377485
  2. Shimizu N, Ohta M, Fujiwara C, Sagara J, Mochizuki N, Oda T, Utiyama H: A gene coding for a zinc finger protein is induced during 12-O-tetradecanoylphorbol-13-acetate-stimulated HL-60 cell differentiation. J Biochem. 1992 Feb;111(2):272-7. 1569051
  3. Wright JJ, Gunter KC, Mitsuya H, Irving SG, Kelly K, Siebenlist U: Expression of a zinc finger gene in HTLV-I- and HTLV-II-transformed cells. Science. 1990 May 4;248(4955):588-91. 2110381
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  6. Hu CT, Chang TY, Cheng CC, Liu CS, Wu JR, Li MC, Wu WS: Snail associates with EGR-1 and SP-1 to upregulate transcriptional activation of p15INK4b. FEBS J. 2010 Mar;277(5):1202-18. doi: 10.1111/j.1742-4658.2009.07553.x. Epub 2010 Feb 1. 20121949