You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameDNA-directed RNA polymerase II subunit RPB3
Synonyms
  • DNA-directed RNA polymerase II 33 kDa polypeptide
  • DNA-directed RNA polymerase II subunit C
  • RNA polymerase II subunit 3
  • RPB31
  • RPB33
Gene NamePOLR2C
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013571|DNA-directed RNA polymerase II subunit RPB3
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLISDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN
Number of residues275
Molecular Weight31440.86
Theoretical pINot Available
GO Classification
Functions
  • DNA binding
  • DNA-directed RNA polymerase activity
Processes
  • transcription from RNA polymerase II promoter
  • gene expression
  • transcription initiation from RNA polymerase II promoter
  • somatic stem cell population maintenance
  • transcription-coupled nucleotide-excision repair
  • viral process
  • 7-methylguanosine mRNA capping
  • gene silencing by RNA
  • mRNA splicing, via spliceosome
  • piRNA metabolic process
  • positive regulation of viral transcription
  • DNA repair
  • RNA splicing
  • transcription elongation from RNA polymerase II promoter
  • nucleotide-excision repair
Components
  • DNA-directed RNA polymerase II, core complex
  • nucleoplasm
  • cytoplasm
  • microtubule cytoskeleton
  • nucleus
General FunctionDna-directed rna polymerase activity
Specific FunctionDNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB3 is part of the core element with the central large cleft and the clamp element that moves to open and close the cleft (By similarity).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP19387
UniProtKB Entry NameRPB3_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0013572|DNA-directed RNA polymerase II subunit RPB3 (POLR2C)
ATGCCGTACGCCAACCAGCCTACCGTGCGGATCACGGAGCTCACTGACGAGAATGTCAAG
TTCATCATCGAGAACACCGACCTGGCGGTGGCCAATTCGATTCGGAGGGTCTTCATCGCT
GAGGTTCCCATAATAGCCATTGACTGGGTTCAGATTGATGCCAATTCCTCAGTTCTTCAT
GATGAATTCATTGCTCACAGGCTTGGATTAATTCCCCTCATTAGTGATGACATTGTGGAC
AAGCTGCAGTACTCTCGGGACTGCACATGTGAGGAGTTCTGCCCCGAGTGCTCGGTGGAG
TTCACCCTCGATGTGCGGTGCAATGAAGACCAGACGCGACATGTCACGTCTCGAGACCTC
ATCTCCAACAGCCCCCGGGTCATTCCGGTGACATCCCGGAACCGAGATAATGACCCCAAT
GACTACGTGGAGCAGGATGACATCCTCATCGTCAAGTTGAGAAAGGGCCAGGAGCTGAGA
CTTCGAGCCTATGCCAAAAAGGGCTTTGGCAAGGAGCATGCCAAGTGGAACCCTACTGCA
GGGGTGGCTTTTGAATACGATCCAGACAATGCCCTGAGGCACACAGTGTACCCCAAGCCC
GAGGAATGGCCAAAGAGTGAGTACTCGGAGCTGGATGAGGATGAGTCGCAGGCTCCCTAT
GACCCCAACGGCAAGCCAGAAAGGTTTTACTACAATGTGGAGTCCTGTGGCTCTCTGCGT
CCTGAAACCATTGTCCTGTCAGCCCTCTCAGGATTGAAGAAGAAACTGAGTGATTTACAA
ACTCAATTAAGCCACGAGATCCAGAGTGATGTGCTAACCATAAATTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9189
Chromosome Location16
LocusNot Available
References
  1. Pati UK, Weissman SM: The amino acid sequence of the human RNA polymerase II 33-kDa subunit hRPB 33 is highly conserved among eukaryotes. J Biol Chem. 1990 May 25;265(15):8400-3. 2187864
  2. Dammann R, Pfeifer GP: Cloning and characterization of the human RNA polymerase I subunit hRPA40. Biochim Biophys Acta. 1998 Mar 9;1396(2):153-7. 9540830
  3. Loftus BJ, Kim UJ, Sneddon VP, Kalush F, Brandon R, Fuhrmann J, Mason T, Crosby ML, Barnstead M, Cronin L, Deslattes Mays A, Cao Y, Xu RX, Kang HL, Mitchell S, Eichler EE, Harris PC, Venter JC, Adams MD: Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q. Genomics. 1999 Sep 15;60(3):295-308. 10493829
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Kershnar E, Wu SY, Chiang CM: Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes. J Biol Chem. 1998 Dec 18;273(51):34444-53. 9852112
  6. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  7. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  8. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. 22814378
  9. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569