Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameCytochrome c oxidase subunit 5A, mitochondrial
Synonyms
  • Cytochrome c oxidase polypeptide Va
Gene NameCOX5A
OrganismHuman
Amino acid sequence
>lcl|BSEQ0012775|Cytochrome c oxidase subunit 5A, mitochondrial
MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYF
NKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHK
EIYPYVIQELRPTLNELGISTPEELGLDKV
Number of residues150
Molecular Weight16761.985
Theoretical pI6.78
GO Classification
Functions
  • electron carrier activity
  • cytochrome-c oxidase activity
  • metal ion binding
Processes
  • gene expression
  • small molecule metabolic process
  • transcription initiation from RNA polymerase II promoter
  • cellular metabolic process
  • respiratory electron transport chain
  • hydrogen ion transmembrane transport
  • mitochondrial electron transport, cytochrome c to oxygen
Components
  • extracellular exosome
  • myelin sheath
  • mitochondrial inner membrane
  • mitochondrial respiratory chain complex IV
General FunctionMetal ion binding
Specific FunctionThis is the heme A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID695360
UniProtKB IDP20674
UniProtKB Entry NameCOX5A_HUMAN
Cellular LocationMitochondrion inner membrane
Gene sequence
>lcl|BSEQ0012776|Cytochrome c oxidase subunit 5A, mitochondrial (COX5A)
ATGCTGGGCGCCGCTCTCCGCCGCTGCGCTGTGGCCGCAACCACCCGGGCCGACCCTCGA
GGCCTCCTGCACTCCGCCCGGACCCCCGGCCCCGCCGTGGCTATCCAGTCAGTTCGCTGC
TATTCCCATGGGTCACAGGAGACAGATGAGGAGTTTGATGCTCGCTGGGTAACATACTTC
AACAAGCCAGATATAGATGCCTGGGAATTGCGTAAAGGGATAAACACACTTGTTACCTAT
GATATGGTTCCAGAGCCCAAAATCATTGATGCTGCTTTGCGGGCATGCAGACGGTTAAAT
GATTTTGCTAGTACAGTTCGTATCCTAGAGGTTGTTAAGGACAAAGCAGGACCTCATAAG
GAAATCTACCCCTATGTCATCCAGGAACTTAGACCAACTTTAAATGAACTGGGAATCTCC
ACTCCGGAGGAACTGGGCCTTGACAAAGTGTAA
GenBank Gene IDM22760
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:2267
Chromosome Location15
Locus15q24.1
References
  1. Rizzuto R, Nakase H, Zeviani M, DiMauro S, Schon EA: Subunit Va of human and bovine cytochrome c oxidase is highly conserved. Gene. 1988 Sep 30;69(2):245-56. 2853101
  2. Uddin M, Opazo JC, Wildman DE, Sherwood CC, Hof PR, Goodman M, Grossman LI: Molecular evolution of the cytochrome c oxidase subunit 5A gene in primates. BMC Evol Biol. 2008 Jan 15;8:8. doi: 10.1186/1471-2148-8-8. 18197981
  3. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. 16572171
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Hughes GJ, Frutiger S, Paquet N, Pasquali C, Sanchez JC, Tissot JD, Bairoch A, Appel RD, Hochstrasser DF: Human liver protein map: update 1993. Electrophoresis. 1993 Nov;14(11):1216-22. 8313870
  6. Kovalyov LI, Shishkin SS, Efimochkin AS, Kovalyova MA, Ershova ES, Egorov TA, Musalyamov AK: The major protein expression profile and two-dimensional protein database of human heart. Electrophoresis. 1995 Jul;16(7):1160-9. 7498159
  7. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  8. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  9. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712