You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSubstance-K receptor
Synonyms
  • Neurokinin A receptor
  • NK-2 receptor
  • NK-2R
  • NK2R
  • NKNAR
  • SKR
  • TAC2R
  • Tachykinin receptor 2
Gene NameTACR2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0016718|Substance-K receptor
MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA
HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK
CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR
HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA
GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI
Number of residues398
Molecular Weight44441.705
Theoretical pI8.74
GO Classification
Functions
  • substance K receptor activity
  • tachykinin receptor activity
Processes
  • negative regulation of luteinizing hormone secretion
  • neuropeptide signaling pathway
  • synaptic transmission
  • positive regulation of smooth muscle contraction
  • cell surface receptor signaling pathway
  • excretion
  • response to electrical stimulus
  • tachykinin receptor signaling pathway
  • muscle contraction
  • prolactin secretion
  • intestine smooth muscle contraction
  • positive regulation of uterine smooth muscle contraction
  • operant conditioning
  • positive regulation of vascular permeability
  • positive regulation of acetylcholine secretion, neurotransmission
Components
  • plasma membrane
  • integral component of plasma membrane
General FunctionTachykinin receptor activity
Specific FunctionThis is a receptor for the tachykinin neuropeptide substance K (neurokinin A). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance K > neuromedin-K > substance P.
Pfam Domain Function
Transmembrane Regions33-56 70-90 108-129 150-170 197-218 252-272 291-310
GenBank Protein ID189135
UniProtKB IDP21452
UniProtKB Entry NameNK2R_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0016719|Substance-K receptor (TACR2)
ATGGGGACCTGTGACATTGTGACTGAAGCCAATATCTCATCTGGCCCTGAGAGCAACACC
ACGGGCATCACAGCCTTCTCCATGCCCAGCTGGCAACTGGCACTGTGGGCCACAGCCTAC
CTGGCCCTGGTGCTGGTGGCCGTGACGGGTAATGCCATCGTCATCTGGATCATCCTGGCC
CATCGGAGGATGCGCACAGTCACCAACTACTTCATCGTCAATCTGGCGCTGGCTGACCTC
TGCATGGCTGCCTTCAATGCCGCCTTCAACTTTGTCTATGCCAGCCACAACATCTGGTAC
TTTGGCCGTGCCTTCTGCTACTTCCAGAACCTCTTCCCCATCACAGCCATGTTTGTCAGC
ATCTACTCCATGACCGCCATTGCTGCCGACAGGTACATGGCCATCGTCCACCCCTTCCAG
CCTCGGCTTTCAGCTCCCAGCACCAAGGCGGTTATTGCTGGCATCTGGCTGGTGGCTCTC
GCCCTGGCCTCCCCTCAGTGCTTCTACTCCACCGTCACCATGGACCAGGGTGCCACCAAG
TGCGTGGTGGCCTGGCCCGAAGACAGCGGGGGCAAGACGCTCCTCCTGTACCACCTCGTG
GTGATCGCCCTCATCTACTTCCTGCCGCTCGCGGTGATGTTTGTAGCCTACAGCGTCATC
GGCCTCACGCTCTGGAGGCGCGCAGTGCCCGGACATCAGGCGCACGGTGCCAACCTGCGC
CACCTGCAGGCCATGAAGAAGTTTGTGAAGACCATGGTGCTGGTGGTGCTGACGTTTGCC
ATCTGCTGGCTGCCCTACCACCTCTACTTCATCCTGGGCAGCTTCCAGGAGGACATCTAC
TGCCACAAGTTCATCCAGCAAGTCTACCTGGCACTCTTCTGGTTGGCCATGAGCTCTACC
ATGTACAATCCCATCATCTACTGCTGTCTCAACCACAGGTTTCGCTCTGGATTCCGGCTT
GCCTTCCGCTGCTGCCCATGGGTCACACCCACCAAGGAAGATAAGCTCGAGCTGACTCCC
ACGACCTCCCTCTCCACGAGAGTCAACAGGTGTCACACTAAGGAGACTTTGTTCATGGCT
GGGGACACAGCCCCCTCCGAGGCTACCAGTGGGGAGGCGGGGCGTCCCCAGGATGGATCA
GGGCTATGGTTTGGGTATGGTTTGCTTGCCCCCACCAAAACTCATGTTGAAATTTGA
GenBank Gene IDM57414
GeneCard IDNot Available
GenAtlas IDTACR2
HGNC IDHGNC:11527
Chromosome Location10
Locus10q11-q21
References
  1. Gerard NP, Eddy RL Jr, Shows TB, Gerard C: The human neurokinin A (substance K) receptor. Molecular cloning of the gene, chromosome localization, and isolation of cDNA from tracheal and gastric tissues. J Biol Chem. 1990 Nov 25;265(33):20455-62. 2173708
  2. Gerard NP, Eddy RL Jr, Shows TB, Gerard C: The human neurokinin A (substance K) receptor. Molecular cloning of the gene, chromosome localization, and isolation of the cDNA from tracheal and gastric tissues. J Biol Chem. 1991 Jan 15;266(2):1354. 1845990
  3. Gerard NP, Gerard C: Molecular cloning of the human neurokinin-2 receptor cDNA by polymerase chain reaction and isolation of the gene. Ann N Y Acad Sci. 1991;632:389-90. 1659296
  4. Cyr C, South V, Saltzman A, Felder S, Ricca GA, Jaye M, Huebner K, Kagan J, Croce CM, Schlessinger J, et al.: Cloning, expression of the human substance K receptor, and analysis of its role in mitogenesis. Ann N Y Acad Sci. 1991;632:426-7. 1659297
  5. Graham A, Hopkins B, Powell SJ, Danks P, Briggs I: Isolation and characterisation of the human lung NK-2 receptor gene using rapid amplification of cDNA ends. Biochem Biophys Res Commun. 1991 May 31;177(1):8-16. 1710456
  6. Kris RM, South V, Saltzman A, Felder S, Ricca GA, Jaye M, Huebner K, Kagan J, Croce CM, Schlessinger J: Cloning and expression of the human substance K receptor and analysis of its role in mitogenesis. Cell Growth Differ. 1991 Jan;2(1):15-22. 1848773
  7. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334