You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameHistone H1t
Synonyms
  • H1FT
  • H1T
  • Testicular H1 histone
Gene NameHIST1H1T
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013483|Histone H1t
MSETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVG
MSLVALKKALAAAGYDVEKNNSRIKLSLKSLVNKGILVQTRGTGASGSFKLSKKVIPKST
RSKAKKSVSAKTKKLVLSRDSKSPKTAKTNKRAKKPRATTPKTVRSGRKAKGAKGKQQQK
SPVKARASKSKLTQHHEVNVRKATSKK
Number of residues207
Molecular Weight22018.82
Theoretical pINot Available
GO Classification
Functions
  • DNA binding
Processes
  • cell differentiation
  • multicellular organismal development
  • sperm motility
  • spermatogenesis
  • binding of sperm to zona pellucida
  • nucleosome assembly
Components
  • nucleus
  • condensed nuclear chromosome
  • nucleosome
General FunctionDna binding
Specific FunctionHistones H1 are necessary for the condensation of nucleosome chains into higher-order structures.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP22492
UniProtKB Entry NameH1T_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0013484|Histone H1t (HIST1H1T)
ATGTCTGAAACCGTGCCTGCAGCTTCTGCCAGTGCTGGTGTAGCCGCTATGGAGAAACTT
CCAACCAAGAAGCGAGGGAGGAAGCCGGCTGGCTTGATAAGTGCAAGTCGCAAAGTGCCG
AACCTCTCTGTGTCCAAGTTGATCACCGAGGCCCTTTCAGTGTCACAGGAACGAGTAGGT
ATGTCTTTGGTTGCGCTCAAGAAGGCATTGGCCGCTGCTGGCTACGACGTAGAGAAGAAT
AACAGCCGCATCAAACTGTCCCTCAAGAGCTTAGTGAACAAGGGAATCCTGGTGCAAACC
AGGGGTACTGGTGCTTCCGGTTCCTTTAAGCTTAGTAAGAAGGTGATTCCTAAATCTACC
AGAAGCAAGGCTAAAAAGTCAGTTTCTGCCAAGACCAAGAAGCTGGTTTTATCCAGGGAC
TCCAAGTCACCAAAGACTGCTAAAACCAATAAGAGAGCCAAGAAGCCGAGAGCGACAACT
CCTAAAACTGTTAGGAGCGGGAGAAAGGCTAAAGGAGCCAAGGGTAAGCAACAGCAGAAG
AGCCCAGTGAAGGCAAGGGCTTCGAAGTCAAAATTGACCCAACATCATGAAGTTAATGTT
AGAAAGGCCACATCTAAGAAGTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:4720
Chromosome Location6
LocusNot Available
References
  1. Drabent B, Kardalinou E, Doenecke D: Structure and expression of the human gene encoding testicular H1 histone (H1t). Gene. 1991 Jul 22;103(2):263-8. 1889752
  2. Koppel DA, Wolfe SA, Fogelfeld LA, Merchant PS, Prouty L, Grimes SR: Primate testicular histone H1t genes are highly conserved and the human H1t gene is located on chromosome 6. J Cell Biochem. 1994 Feb;54(2):219-30. 8175896
  3. Marzluff WF, Gongidi P, Woods KR, Jin J, Maltais LJ: The human and mouse replication-dependent histone genes. Genomics. 2002 Nov;80(5):487-98. 12408966
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334