You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameReceptor-type tyrosine-protein phosphatase gamma
Synonyms
  • 3.1.3.48
  • Protein-tyrosine phosphatase gamma
  • PTPG
Gene NamePTPRG
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009007|Receptor-type tyrosine-protein phosphatase gamma
MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYW
AYSGAYGPEHWVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNT
GKTVAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSINGRRFPVEMQIFFYN
PDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFVLRD
LLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVE
YLRNNFRPQQRLHDRVVSKSAVRDSWNHDMTDFLENPLGTEASKVCSSPPIHMKVQPLNQ
TALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSLYL
FRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTW
TSSGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPT
AASASKQAARPVLATTEALASPGPDGDSSPTKDGEGTEEGEKDEKSESEDGEREHEEDGE
KDSEKKEKSGVTHAAEERNQTEPSPTPSSPNRTAEGGHQTIPGHEQDHTAVPTDQTGGRR
DAGPGLDPDMVTSTQVPPTATEEQYAGSDPKRPEMPSKKPMSRGDRFSEDSRFITVNPAE
KNTSGMISRPAPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRGCNKIKSKGFPRRFREV
PSSGERGEKGSRKCFQTAHFYVEDSSSPRVVPNESIPIIPIPDDMEAIPVKQFVKHIGEL
YSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKD
SKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRK
CDQYWPTENSEEYGNIIVTLKSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQ
YHYTQWPDMGVPEYALPVLTFVRRSSAARMPETGPVLVHCSAGVGRTGTYIVIDSMLQQI
KDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSNQLHSYVNSIL
IPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPSERARVGLAPLPGM
KGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEF
VYWPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFQCPKWP
NPDAPISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVF
QVAKMINLMRPGVFTDIEQYQFIYKAMLSLVSTKENGNGPMTVDKNGAVLIADESDPAES
MESLV
Number of residues1445
Molecular Weight162002.3
Theoretical pINot Available
GO Classification
Functions
  • protein tyrosine phosphatase activity
  • identical protein binding
  • transmembrane receptor protein tyrosine phosphatase activity
Processes
  • peptidyl-tyrosine dephosphorylation
  • toxin transport
  • negative regulation of epithelial cell migration
  • transmembrane receptor protein tyrosine kinase signaling pathway
Components
  • extracellular exosome
  • integral component of plasma membrane
General FunctionTransmembrane receptor protein tyrosine phosphatase activity
Specific FunctionPossesses tyrosine phosphatase activity.
Pfam Domain Function
Transmembrane Regions737-762
GenBank Protein IDNot Available
UniProtKB IDP23470
UniProtKB Entry NamePTPRG_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0021722|Receptor-type tyrosine-protein phosphatase gamma (PTPRG)
ATGCGGAGGTTACTGGAACCGTGTTGGTGGATTTTGTTCCTGAAAATCACCAGTTCCGTG
CTCCATTATGTCGTGTGCTTCCCCGCGTTGACAGAAGGCTACGTTGGGGCCCTGCACGAG
AATAGACACGGCAGCGCAGTGCAGATCCGCAGGCGCAAGGCTTCAGGCGACCCGTACTGG
GCCTACTCTGGTGCCTATGGTCCTGAGCACTGGGTCACGTCTAGTGTCAGCTGTGGGGGC
CGTCACCAGTCTCCTATTGACATTTTAGACCAGTATGCGCGTGTTGGGGAAGAATACCAG
GAACTGCAACTCGATGGCTTCGACAATGAGTCTTCTAACAAAACCTGGATGAAAAACACA
GGGAAAACAGTCGCCATCCTTCTGAAAGACGACTATTTTGTCAGTGGAGCTGGTCTACCT
GGCAGATTCAAAGCTGAGAAGGTGGAATTTCACTGGGGCCACAGCAATGGCTCAGCGGGC
TCTGAACACAGCATCAATGGCAGGAGGTTTCCTGTTGAGATGCAGATTTTCTTTTACAAT
CCAGATGACTTTGACAGCTTTCAAACCGCAATTTCTGAGAACAGAATAATCGGAGCCATG
GCCATATTTTTTCAAGTCAGTCCGAGGGACAATTCTGCACTGGATCCTATTATCCACGGG
TTGAAGGGTGTCGTACATCATGAGAAGGAGACCTTTCTGGATCCTTTCGTCCTCCGGGAC
CTCCTGCCTGCATCCCTGGGCAGCTATTATCGGTACACAGGTTCCTTGACCACACCACCG
TGTAGCGAAATAGTGGAGTGGATAGTCTTCCGGAGACCCGTCCCCATCTCTTACCATCAG
CTTGAGGCTTTTTATTCCATCTTCACCACGGAGCAGCAAGACCATGTCAAGTCGGTGGAG
TATCTGAGAAATAACTTTCGACCACAGCAGCGTCTGCATGACAGGGTGGTGTCCAAGTCC
GCCGTCCGTGACTCCTGGAACCACGACATGACAGACTTCTTAGAAAACCCACTGGGGACA
GAAGCCTCTAAAGTTTGCAGCTCTCCACCCATCCACATGAAGGTGCAGCCTCTGAACCAG
ACGGCACTGCAGGTGTCCTGGAGCCAGCCGGAGACTATCTACCACCCACCCATCATGAAC
TACATGATCTCCTACAGCTGGACCAAGAATGAGGACGAGAAGGAGAAGACGTTTACAAAG
GACAGCGACAAAGACTTGAAAGCCACCATTAGCCATGTCTCACCCGATAGCCTTTACCTG
TTCCGAGTCCAGGCCGTGTGTCGGAACGACATGCGCAGCGACTTTAGCCAGACGATGCTG
TTTCAAGCTAATACCACTCGAATATTCCAAGGGACCAGAATAGTGAAAACAGGAGTGCCC
ACAGCGTCTCCTGCCTCTTCAGCCGACATGGCCCCCATCAGCTCGGGGTCTTCTACCTGG
ACGTCCTCTGGCATCCCATTCTCATTTGTTTCCATGGCAACTGGGATGGGCCCCTCCTCC
AGTGGCAGCCAGGCCACAGTGGCCTCGGTGGTCACCAGCACGCTGCTCGCCGGCCTGGGG
TTCGGCGGTGGTGGCATCTCCTCTTTCCCCAGCACTGTGTGGCCCACGCGCCTCCCGACG
GCCGCCTCAGCCAGCAAGCAGGCGGCTAGGCCAGTCCTAGCCACCACAGAGGCCTTGGCT
TCTCCAGGGCCCGATGGTGATTCGTCACCAACCAAGGACGGCGAGGGCACCGAGGAAGGA
GAGAAGGATGAGAAAAGCGAGAGTGAGGATGGGGAGCGGGAGCACGAGGAGGATGGAGAG
AAGGACTCCGAAAAGAAGGAGAAGAGTGGGGTGACCCACGCTGCCGAGGAGCGGAATCAG
ACGGAGCCCAGCCCCACACCCTCGTCTCCTAACAGGACTGCCGAGGGAGGGCATCAGACT
ATACCTGGGCATGAGCAGGATCACACTGCCGTCCCCACAGACCAGACGGGCGGAAGGAGG
GATGCCGGCCCAGGCCTGGACCCCGACATGGTCACCTCCACCCAAGTGCCCCCCACCGCC
ACAGAGGAGCAGTATGCAGGGAGTGATCCCAAGAGGCCCGAAATGCCATCTAAAAAGCCT
ATGTCCCGCGGGGACCGATTTTCTGAAGACAGCAGATTTATCACTGTTAATCCAGCGGAA
AAAAACACCTCTGGAATGATAAGCCGCCCTGCTCCAGGGAGGATGGAGTGGATCATCCCT
CTGATTGTGGTATCAGCCTTGACCTTCGTGTGCCTCATCCTTCTCATTGCTGTGCTCGTT
TACTGGAGAGGGTGTAACAAAATAAAGTCCAAGGGCTTTCCCAGACGTTTCCGTGAAGTG
CCTTCTTCTGGGGAGAGAGGAGAGAAGGGGAGCAGAAAATGTTTTCAGACTGCTCATTTC
TATGTGGAAGACAGCAGTTCACCTCGAGTGGTCCCTAATGAAAGTATCCCTATTATTCCT
ATTCCGGATGACATGGAAGCCATTCCTGTCAAACAGTTTGTCAAACACATCGGTGAGCTC
TATTCTAATAACCAGCATGGGTTCTCTGAGGATTTTGAGGAAGTCCAGCGCTGTACTGCT
GATATGAACATCACTGCAGAGCATTCCAATCATCCAGAAAACAAGCACAAAAACAGATAC
ATCAACATTTTAGCATATGATCACAGTAGGGTGAAGTTAAGACCTTTACCAGGAAAAGAC
TCTAAGCACAGCGACTACATTAATGCAAACTATGTTGATGGTTACAACAAAGCAAAAGCC
TACATTGCCACCCAAGGACCTTTGAAGTCTACATTTGAAGATTTCTGGAGGATGATTTGG
GAACAAAACACTGGAATCATTGTGATGATTACGAACCTTGTGGAAAAAGGAAGACGAAAA
TGTGATCAGTATTGGCCAACAGAGAACAGTGAGGAATATGGAAACATTATTGTCACGCTG
AAGAGCACAAAAATACATGCCTGCTACACTGTTCGTCGTTTTTCAATCAGAAATACAAAA
GTGAAAAAGGGTCAGAAGGGAAATCCCAAGGGTCGTCAGAATGAAAGGGTAGTGATCCAG
TATCACTATACACAGTGGCCTGACATGGGAGTTCCCGAGTATGCCCTTCCAGTACTGACT
TTCGTGAGGAGATCCTCAGCAGCTCGGATGCCAGAAACGGGCCCTGTGTTGGTGCACTGC
AGTGCTGGTGTGGGCAGAACAGGCACCTATATTGTAATAGACAGCATGCTGCAACAGATA
AAAGACAAAAGCACAGTTAACGTCCTGGGATTCCTGAAGCATATCAGGACACAGCGTAAC
TACCTCGTCCAGACTGAGGAGCAGTACATTTTCATCCATGATGCCTTGTTGGAAGCCATT
CTTGGAAAGGAGACTGAAGTATCTTCAAATCAGCTGCACAGCTATGTTAACAGCATCCTT
ATACCAGGAGTAGGAGGAAAGACACGACTGGAAAAGCAATTCAAGCTGGTCACACAGTGT
AATGCAAAATATGTGGAATGTTTCAGTGCTCAGAAAGAGTGTAACAAAGAAAAGAACAGA
AACTCTTCAGTTGTGCCATCTGAGCGTGCTCGAGTGGGTCTTGCACCATTGCCTGGAATG
AAAGGAACAGATTACATTAATGCTTCTTATATCATGGGCTATTATAGGAGCAATGAATTT
ATTATAACTCAGCATCCTCTGCCACATACTACGAAAGATTTCTGGCGAATGATTTGGGAT
CATAACGCACAGATCATTGTCATGCTGCCAGACAACCAGAGCTTGGCAGAAGATGAGTTT
GTGTACTGGCCAAGTCGAGAAGAATCCATGAACTGTGAGGCCTTTACCGTCACCCTTATC
AGCAAAGACAGACTGTGCCTCTCTAATGAAGAACAAATTATCATCCATGACTTTATCCTT
GAAGCTACACAGGATGACTATGTCTTAGAAGTTCGGCACTTTCAGTGTCCCAAATGGCCT
AACCCAGATGCCCCCATAAGTAGTACCTTTGAACTTATCAACGTCATCAAGGAAGAGGCC
TTAACAAGGGATGGTCCCACCATTGTTCATGATGAGTATGGAGCAGTTTCAGCAGGAATG
TTATGTGCCCTTACCACCCTGTCCCAGCAACTGGAGAATGAAAATGCTGTGGATGTTTTC
CAGGTTGCAAAAATGATCAATCTTATGAGGCCTGGAGTATTCACAGACATTGAACAATAC
CAGTTCATCTATAAAGCAATGCTTAGCTTGGTCAGCACTAAAGAAAATGGAAATGGTCCC
ATGACAGTAGACAAAAATGGTGCTGTTCTTATTGCAGATGAATCAGACCCTGCTGAGAGC
ATGGAGTCCCTAGTGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9671
Chromosome Location3
LocusNot Available
References
  1. Barnea G, Silvennoinen O, Shaanan B, Honegger AM, Canoll PD, D'Eustachio P, Morse B, Levy JB, Laforgia S, Huebner K, et al.: Identification of a carbonic anhydrase-like domain in the extracellular region of RPTP gamma defines a new subfamily of receptor tyrosine phosphatases. Mol Cell Biol. 1993 Mar;13(3):1497-506. 8382771
  2. Kastury K, Ohta M, Lasota J, Moir D, Dorman T, LaForgia S, Druck T, Huebner K: Structure of the human receptor tyrosine phosphatase gamma gene (PTPRG) and relation to the familial RCC t(3;8) chromosome translocation. Genomics. 1996 Mar 1;32(2):225-35. 8833149
  3. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. 16641997
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  6. Krueger NX, Streuli M, Saito H: Structural diversity and evolution of human receptor-like protein tyrosine phosphatases. EMBO J. 1990 Oct;9(10):3241-52. 2170109
  7. Kaplan R, Morse B, Huebner K, Croce C, Howk R, Ravera M, Ricca G, Jaye M, Schlessinger J: Cloning of three human tyrosine phosphatases reveals a multigene family of receptor-linked protein-tyrosine-phosphatases expressed in brain. Proc Natl Acad Sci U S A. 1990 Sep;87(18):7000-4. 2169617
  8. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. 16335952
  9. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  10. Barr AJ, Ugochukwu E, Lee WH, King ON, Filippakopoulos P, Alfano I, Savitsky P, Burgess-Brown NA, Muller S, Knapp S: Large-scale structural analysis of the classical human protein tyrosine phosphatome. Cell. 2009 Jan 23;136(2):352-63. doi: 10.1016/j.cell.2008.11.038. 19167335
  11. Bouyain S, Watkins DJ: The protein tyrosine phosphatases PTPRZ and PTPRG bind to distinct members of the contactin family of neural recognition molecules. Proc Natl Acad Sci U S A. 2010 Feb 9;107(6):2443-8. doi: 10.1073/pnas.0911235107. Epub 2010 Jan 21. 20133774