You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NamePlasma membrane calcium-transporting ATPase 4
Synonyms
  • 3.6.3.8
  • ATP2B2
  • Matrix-remodeling-associated protein 1
  • MXRA1
  • Plasma membrane calcium ATPase isoform 4
  • Plasma membrane calcium pump isoform 4
  • PMCA4
Gene NameATP2B4
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008740|Plasma membrane calcium-transporting ATPase 4
MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKT
SPVEGLSGNPADLEKRRQVFGHNVIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLS
FYRPAGEENELCGQVATTPEDENEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGL
QCRIEQEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLT
GESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIILTLLGVNEDDEGEKKKK
GKKQGVPENRNKAKTQDGVALEIQPLNSQEGIDNEEKDKKAVKVPKKEKSVLQGKLTRLA
VQIGKAGLLMSALTVFILILYFVIDNFVINRRPWLPECTPIYIQYFVKFFIIGITVLVVA
VPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQA
YIGGIHYRQIPSPDVFLPKVLDLIVNGISINSAYTSKILPPEKEGGLPRQVGNKTECALL
GFVTDLKQDYQAVRNEVPEEKLYKVYTFNSVRKSMSTVIRNPNGGFRMYSKGASEIILRK
CNRILDRKGEAVPFKNKDRDDMVRTVIEPMACDGLRTICIAYRDFDDTEPSWDNENEILT
ELTCIAVVGIEDPVRPEVPDAIAKCKQAGITVRMVTGDNINTARAIATKCGILTPGDDFL
CLEGKEFNRLIRNEKGEVEQEKLDKIWPKLRVLARSSPTDKHTLVKGIIDSTVGEHRQVV
AVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI
SKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLL
KRRPYGRNKPLISRTMMKNILGHAFYQLIVIFILVFAGEKFFDIDSGRKAPLHSPPSQHY
TIVFNTFVLMQLFNEINSRKIHGEKNVFSGIYRNIIFCSVVLGTFICQIFIVEFGGKPFS
CTSLSLSQWLWCLFIGIGELLWGQFISAIPTRSLKFLKEAGHGTTKEEITKDAEGLDEID
HAEMELRRGQILWFRGLNRIQTQIDVINTFQTGASFKGVLRRQNMGQHLDVKLVPSSSYI
KVVKAFHSSLHESIQKPYNQKSIHSFMTHPEFAIEEELPRTPLLDEEEEENPDKASKFGT
RVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV
Number of residues1241
Molecular Weight137919.03
Theoretical pINot Available
GO Classification
Functions
  • ATP binding
  • PDZ domain binding
  • calcium-transporting ATPase activity
  • metal ion binding
  • nitric-oxide synthase binding
  • calmodulin binding
  • nitric-oxide synthase inhibitor activity
  • scaffold protein binding
  • protein phosphatase 2B binding
Processes
  • regulation of transcription from RNA polymerase II promoter
  • negative regulation of adrenergic receptor signaling pathway involved in heart process
  • response to hydrostatic pressure
  • blood coagulation
  • negative regulation of arginine catabolic process
  • negative regulation of nitric oxide biosynthetic process
  • negative regulation of cardiac muscle hypertrophy in response to stress
  • calcium ion transmembrane transport
  • negative regulation of citrulline biosynthetic process
  • cellular calcium ion homeostasis
  • calcium ion import across plasma membrane
  • negative regulation of nitric oxide mediated signal transduction
  • sperm motility
  • cellular response to epinephrine stimulus
  • negative regulation of the force of heart contraction
  • negative regulation of peptidyl-cysteine S-nitrosylation
  • transmembrane transport
  • positive regulation of cAMP-dependent protein kinase activity
  • negative regulation of calcineurin-NFAT signaling cascade
  • regulation of cell cycle G1/S phase transition
  • ion transmembrane transport
  • positive regulation of peptidyl-serine phosphorylation
  • regulation of sodium ion transmembrane transport
  • calcium ion transmembrane import into cytosol
  • negative regulation of nitric-oxide synthase activity
Components
  • caveola
  • sperm flagellum
  • plasma membrane
  • integral component of plasma membrane
  • T-tubule
  • Z disc
  • intracellular membrane-bounded organelle
  • membrane
  • protein complex
General FunctionScaffold protein binding
Specific FunctionCalcium/calmodulin-regulated and magnesium-dependent enzyme that catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell (PubMed:8530416). By regulating sperm cell calcium homeostasis, may play a role in sperm motility (By similarity).
Pfam Domain Function
Transmembrane Regions93-113 151-171 357-376 410-427 841-860 871-891 912-934 953-974 994-1015 1026-1047
GenBank Protein IDNot Available
UniProtKB IDP23634
UniProtKB Entry NameAT2B4_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0019657|Plasma membrane calcium-transporting ATPase 4 (ATP2B4)
ATGACGAACCCATCAGACCGTGTCTTGCCTGCCAACTCGATGGCCGAGAGCCGTGAAGGG
GACTTTGGCTGCACAGTAATGGAACTGAGGAAGCTCATGGAGCTGCGTTCAAGGGATGCA
CTGACCCAGATTAATGTCCACTATGGAGGTGTACAGAATCTCTGCAGTAGACTGAAAACC
TCCCCTGTGGAAGGTCTGTCTGGGAACCCTGCAGATCTGGAGAAACGTAGGCAGGTGTTT
GGACACAACGTGATCCCCCCCAAAAAGCCCAAGACTTTCTTAGAATTAGTGTGGGAAGCT
CTTCAAGATGTCACGCTTATCATCCTGGAGATTGCAGCCATCATCTCCCTGGTCCTGTCC
TTTTATCGCCCTGCTGGTGAAGAAAATGAACTGTGTGGTCAAGTCGCAACTACCCCAGAA
GATGAAAATGAGGCACAAGCTGGCTGGATTGAGGGGGCAGCCATCCTTTTCTCAGTGATC
ATCGTGGTGTTAGTGACTGCCTTTAATGATTGGAGCAAAGAGAAGCAATTCCGGGGGCTG
CAGTGCCGCATTGAACAGGAGCAAAAGTTCTCCATCATCCGAAACGGTCAACTCATCCAG
CTCCCTGTGGCTGAGATTGTGGTTGGTGATATTGCCCAAGTCAAATACGGTGATCTGCTG
CCTGCAGATGGAATCCTGATCCAAGGGAATGATCTGAAGATTGATGAGAGCTCTCTGACA
GGGGAATCTGACCATGTCAAGAAGTCCCTGGACAAAGACCCCATGTTGCTCTCAGGGACC
CATGTCATGGAAGGTTCTGGCCGGATGGTGGTGACAGCTGTTGGTGTCAACTCTCAGACT
GGAATCATCCTTACTCTCTTGGGGGTCAATGAGGATGACGAAGGGGAGAAAAAGAAGAAA
GGTAAAAAACAAGGAGTCCCTGAAAATCGCAACAAAGCAAAGACCCAAGACGGAGTGGCC
CTGGAAATCCAGCCACTCAACAGCCAGGAGGGAATCGACAATGAGGAAAAGGACAAGAAG
GCAGTCAAGGTGCCTAAAAAGGAGAAGTCAGTGCTGCAGGGCAAGCTGACTCGCCTGGCT
GTTCAGATTGGGAAAGCCGGTCTGCTCATGTCTGCTCTCACGGTTTTCATCCTGATTCTA
TACTTTGTGATTGACAACTTTGTGATAAATCGCAGACCATGGCTCCCTGAGTGTACTCCC
ATCTACATCCAGTACTTTGTCAAGTTCTTCATCATCGGCATCACTGTACTGGTGGTGGCT
GTGCCAGAGGGGCTGCCTCTGGCTGTCACCATCTCACTGGCCTACTCTGTGAAGAAAATG
ATGAAAGACAATAACCTAGTACGGCACTTGGATGCTTGTGAGACCATGGGCAACGCCACC
GCCATCTGCTCTGATAAGACAGGCACGTTGACCATGAACCGCATGACTGTGGTACAAGCT
TATATTGGGGGCATCCATTACCGTCAAATCCCAAGCCCTGATGTCTTCCTGCCCAAAGTC
CTGGACCTCATTGTCAATGGCATTTCTATCAACAGTGCTTATACCTCCAAGATTCTGCCT
CCAGAGAAGGAGGGAGGCCTGCCTCGGCAGGTGGGCAACAAGACCGAGTGTGCTCTGCTA
GGCTTTGTCACAGATCTGAAGCAGGATTATCAGGCTGTGCGTAATGAAGTGCCCGAGGAG
AAGCTCTACAAGGTGTACACCTTTAACTCAGTGCGCAAGTCAATGAGCACCGTCATCAGG
AATCCCAACGGTGGCTTCCGTATGTACAGCAAGGGCGCCTCTGAGATCATCTTGCGCAAG
TGTAATCGAATCCTGGACCGGAAAGGGGAAGCAGTGCCATTCAAGAATAAAGACAGAGAT
GATATGGTACGCACTGTCATCGAGCCCATGGCCTGTGATGGACTCCGGACTATCTGCATA
GCTTACCGGGACTTCGATGACACAGAGCCCTCTTGGGACAATGAGAATGAGATCCTCACC
GAACTGACCTGTATCGCGGTGGTGGGCATTGAGGACCCTGTGCGCCCAGAGGTGCCAGAT
GCTATTGCCAAATGCAAACAAGCTGGCATTACTGTCAGAATGGTGACAGGTGACAACATC
AACACAGCCCGGGCCATTGCCACCAAATGTGGCATTCTGACACCTGGGGATGACTTCCTG
TGCTTAGAAGGCAAAGAATTCAACCGGCTCATCCGCAACGAGAAAGGCGAGGTAGAGCAA
GAAAAGCTGGACAAGATCTGGCCTAAGCTTCGGGTCCTGGCGCGATCTTCTCCCACTGAC
AAGCACACCCTGGTGAAAGGCATAATTGACAGCACTGTTGGGGAACACCGGCAGGTCGTG
GCTGTCACTGGTGATGGCACAAATGACGGGCCTGCTCTGAAGAAAGCGGATGTTGGTTTT
GCCATGGGCATCGCAGGCACAGATGTAGCAAAGGAGGCTTCAGACATCATCCTAACAGAT
GACAACTTCACCAGCATTGTGAAGGCAGTGATGTGGGGACGAAATGTCTATGACAGCATC
TCCAAGTTCCTGCAGTTCCAGCTCACTGTCAATGTGGTGGCCGTGATTGTAGCCTTCACT
GGAGCCTGTATCACTCAGGATTCCCCATTGAAAGCTGTGCAGATGTTGTGGGTTAATCTG
ATCATGGACACTTTTGCTTCATTGGCCCTGGCCACAGAGCCCCCTACGGAATCTCTGTTG
AAGCGGCGCCCCTATGGCCGAAATAAGCCTCTGATCTCACGCACTATGATGAAGAACATC
TTGGGCCATGCATTCTATCAGCTCATTGTCATCTTTATCCTTGTCTTTGCGGGTGAGAAA
TTCTTTGATATTGATAGTGGGAGGAAGGCACCTCTACATTCACCACCCAGCCAGCACTAT
ACCATTGTTTTTAACACCTTCGTGCTGATGCAGCTCTTCAATGAAATCAACTCCCGAAAG
ATCCATGGAGAGAAGAACGTCTTTTCAGGCATCTACCGCAACATTATCTTCTGCTCTGTA
GTCTTGGGCACATTCATCTGCCAGATTTTCATCGTGGAATTTGGGGGTAAACCCTTCAGT
TGTACAAGCCTCAGCCTGTCTCAGTGGCTGTGGTGTCTCTTCATTGGGATTGGAGAACTT
CTGTGGGGCCAGTTCATCTCCGCAATACCTACCCGATCCCTGAAGTTCCTGAAGGAGGCT
GGGCATGGCACCACCAAAGAGGAGATCACCAAGGATGCCGAGGGACTGGATGAGATTGAC
CATGCTGAGATGGAGCTGCGCCGAGGCCAGATCCTCTGGTTCCGGGGCCTGAACCGTATC
CAGACTCAGATCGACGTAATTAACACATTCCAGACGGGAGCCTCTTTTAAGGGAGTCCTA
AGGCGACAGAACATGGGTCAACACCTTGATGTAAAACTTGTTCCTAGTTCATCCTATGTA
GCAGTTGCACCAGTCAAATCTTCCCCCACCACTTCTGTTCCTGCTGTTTCATCTCCTCCT
ATGGGCAATCAAAGTGGTCAAAGCGTTCCATAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:817
Chromosome Location1
LocusNot Available
References
  1. Strehler EE, James P, Fischer R, Heim R, Vorherr T, Filoteo AG, Penniston JT, Carafoli E: Peptide sequence analysis and molecular cloning reveal two calcium pump isoforms in the human erythrocyte membrane. J Biol Chem. 1990 Feb 15;265(5):2835-42. 2137451
  2. Brandt P, Neve RL, Kammesheidt A, Rhoads RE, Vanaman TC: Analysis of the tissue-specific distribution of mRNAs encoding the plasma membrane calcium-pumping ATPases and characterization of an alternately spliced form of PMCA4 at the cDNA and genomic levels. J Biol Chem. 1992 Mar 5;267(7):4376-85. 1531651
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  4. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Santiago-Garcia J, Mas-Oliva J, Saavedra D, Zarain-Herzberg A: Analysis of mRNA expression and cloning of a novel plasma membrane Ca(2+)-ATPase splice variant in human heart. Mol Cell Biochem. 1996 Feb 23;155(2):173-82. 8700162
  7. James P, Maeda M, Fischer R, Verma AK, Krebs J, Penniston JT, Carafoli E: Identification and primary structure of a calmodulin binding domain of the Ca2+ pump of human erythrocytes. J Biol Chem. 1988 Feb 25;263(6):2905-10. 2963820
  8. Brandt P, Zurini M, Neve RL, Rhoads RE, Vanaman TC: A C-terminal, calmodulin-like regulatory domain from the plasma membrane Ca2+-pumping ATPase. Proc Natl Acad Sci U S A. 1988 May;85(9):2914-8. 2966397
  9. Stauffer TP, Hilfiker H, Carafoli E, Strehler EE: Quantitative analysis of alternative splicing options of human plasma membrane calcium pump genes. J Biol Chem. 1993 Dec 5;268(34):25993-6003. 8245032
  10. Stauffer TP, Hilfiker H, Carafoli E, Strehler EE: Quantitative analysis of alternative splicing options of human plasma membrane calcium pump genes. J Biol Chem. 1994 Dec 16;269(50):32022. 7989379
  11. Adamo HP, Filoteo AG, Enyedi A, Penniston JT: Mutants in the putative nucleotide-binding region of the plasma membrane Ca(2+)-pump. A reduction in activity due to slow dephosphorylation. J Biol Chem. 1995 Dec 15;270(50):30111-4. 8530416
  12. Goellner GM, DeMarco SJ, Strehler EE: Characterization of PISP, a novel single-PDZ protein that binds to all plasma membrane Ca2+-ATPase b-splice variants. Ann N Y Acad Sci. 2003 Apr;986:461-71. 12763866
  13. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  14. Krapivinsky G, Krapivinsky L, Stotz SC, Manasian Y, Clapham DE: POST, partner of stromal interaction molecule 1 (STIM1), targets STIM1 to multiple transporters. Proc Natl Acad Sci U S A. 2011 Nov 29;108(48):19234-9. doi: 10.1073/pnas.1117231108. Epub 2011 Nov 14. 22084111
  15. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  16. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712
  17. Elshorst B, Hennig M, Forsterling H, Diener A, Maurer M, Schulte P, Schwalbe H, Griesinger C, Krebs J, Schmid H, Vorherr T, Carafoli E: NMR solution structure of a complex of calmodulin with a binding peptide of the Ca2+ pump. Biochemistry. 1999 Sep 21;38(38):12320-32. 10493800