Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameCytochrome P450 3A7
Synonyms
  • 1.14.14.1
  • CYPIIIA7
  • Cytochrome P450-HFLA
Gene NameCYP3A7
OrganismHuman
Amino acid sequence
>lcl|BSEQ0006949|Cytochrome P450 3A7
MDLIPNLAVETWLLLAVSLILLYLYGTRTHGLFKKLGIPGPTPLPFLGNALSFRKGYWTF
DMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKNAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYS
MDVITSTSFGVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIKVFPFLTPILEALNITV
FPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
IFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLDMVV
NETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWREPEKFLPERFS
KKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFG
GLLLTEKPIVLKAESRDETVSGA
Number of residues503
Molecular Weight57525.03
Theoretical pI9.59
GO Classification
Functions
  • aromatase activity
  • iron ion binding
  • heme binding
  • monooxygenase activity
  • oxygen binding
Processes
  • small molecule metabolic process
  • xenobiotic metabolic process
Components
  • endoplasmic reticulum membrane
General FunctionOxygen binding
Specific FunctionCytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID220149
UniProtKB IDP24462
UniProtKB Entry NameCP3A7_HUMAN
Cellular LocationEndoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0019448|Cytochrome P450 3A7 (CYP3A7)
ATGGATCTCATCCCAAACTTGGCCGTGGAAACCTGGCTTCTCCTGGCTGTCAGCCTGATA
CTCCTCTATCTATATGGAACCCGTACACATGGACTTTTTAAGAAGCTTGGAATTCCAGGG
CCCACACCTCTGCCTTTTTTGGGAAATGCTTTGTCCTTCCGTAAGGGCTATTGGACGTTT
GACATGGAATGTTATAAAAAGTATAGAAAAGTCTGGGGTATTTATGACTGTCAACAGCCT
ATGCTGGCTATCACAGATCCCGACATGATCAAAACAGTGCTAGTGAAAGAATGTTATTCT
GTCTTCACAAACCGGAGGCCTTTCGGGCCAGTGGGATTTATGAAAAATGCCATCTCTATA
GCTGAGGATGAAGAATGGAAGAGAATACGATCATTGCTGTCTCCAACATTCACCAGCGGA
AAACTCAAGGAGATGGTCCCTATCATTGCCCAGTATGGAGATGTGTTGGTGAGAAATCTG
AGGCGGGAAGCAGAGACAGGCAAGCCTGTCACCTTGAAACACGTCTTTGGGGCCTACAGC
ATGGATGTGATCACTAGCACATCATTTGGAGTGAGCATCGACTCTCTCAACAATCCACAA
GACCCCTTTGTGGAAAACACCAAGAAGCTTTTAAGATTTAATCCATTAGATCCATTCGTT
CTCTCAATAAAAGTCTTTCCATTCCTTACCCCAATTCTTGAAGCATTAAATATCACTGTG
TTTCCAAGAAAAGTTATAAGTTTTCTAACAAAATCTGTAAAACAGATAAAAGAAGGTCGC
CTCAAAGAGACACAAAAGCACCGAGTGGATTTCCTTCAGCTGATGATTGACTCTCAGAAT
TCAAAAGACTCTGAGACCCACAAAGCTCTGTCTGATCTGGAGCTCATGGCCCAATCAATT
ATCTTTATTTTTGCTGGCTATGAAACCACGAGCAGTGTTCTCTCCTTCATTATATATGAA
CTGGCCACTCACCCTGATGTCCAGCAGAAAGTGCAGAAGGAAATTGATACAGTTTTACCC
AATAAGGCACCACCCACCTATGATACTGTGCTACAGTTGGAGTATCTTGACATGGTGGTG
AATGAAACACTCAGATTATTCCCAGTTGCTATGAGACTTGAGAGGGTCTGCAAAAAAGAT
GTTGAAATCAATGGGATGTTTATTCCCAAAGGGGTGGTGGTGATGATTCCAAGCTATGTT
CTTCATCATGACCCAAAGTACTGGACAGAGCCTGAGAAGTTCCTCCCTGAAAGGTTCAGT
AAAAAGAACAAGGACAACATAGATCCTTACATATACACACCCTTTGGAAGTGGACCCAGA
AACTGCATTGGCATGAGGTTTGCTCTCGTGAACATGAAACTTGCTCTAGTCAGAGTCCTT
CAGAACTTCTCCTTCAAACCTTGTAAAGAAACACAGATCCCCCTGAAATTACGCTTTGGA
GGACTTCTTCTAACAGAAAAACCCATTGTTCTAAAGGCTGAGTCAAGGGATGAGACCTTT
GTAGATATGGAGCCCATTCACATGGACTTTTTAAGAAGCTTGGCATTCCAGGGCCCACAC
CTCTGCTTTTTTTGGGAACTACTTTGTCCTACCATCAGATCCCGCTGA
GenBank Gene IDD00408
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:2640
Chromosome Location7
Locus7q21-q22.1
References
  1. Komori M, Nishio K, Ohi H, Kitada M, Kamataki T: Molecular cloning and sequence analysis of cDNA containing the entire coding region for human fetal liver cytochrome P-450. J Biochem. 1989 Feb;105(2):161-3. 2722762
  2. Finta C, Zaphiropoulos PG: The human cytochrome P450 3A locus. Gene evolution by capture of downstream exons. Gene. 2000 Dec 30;260(1-2):13-23. 11137287
  3. Gellner K, Eiselt R, Hustert E, Arnold H, Koch I, Haberl M, Deglmann CJ, Burk O, Buntefuss D, Escher S, Bishop C, Koebe HG, Brinkmann U, Klenk HP, Kleine K, Meyer UA, Wojnowski L: Genomic organization of the human CYP3A locus: identification of a new, inducible CYP3A gene. Pharmacogenetics. 2001 Mar;11(2):111-21. 11266076
  4. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. 12690205
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Wrighton SA, Vandenbranden M: Isolation and characterization of human fetal liver cytochrome P450HLp2: a third member of the P450III gene family. Arch Biochem Biophys. 1989 Jan;268(1):144-51. 2492179
  7. Komori M, Nishio K, Fujitani T, Ohi H, Kitada M, Mima S, Itahashi K, Kamataki T: Isolation of a new human fetal liver cytochrome P450 cDNA clone: evidence for expression of a limited number of forms of cytochrome P450 in human fetal livers. Arch Biochem Biophys. 1989 Jul;272(1):219-25. 2786707