You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSubstance-P receptor
Synonyms
  • NK-1 receptor
  • NK-1R
  • NK1R
  • SPR
  • TAC1R
  • Tachykinin receptor 1
Gene NameTACR1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0000765|Substance-P receptor
MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH
KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTIST
VVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS
Number of residues407
Molecular Weight46250.5
Theoretical pI7.22
GO Classification
Functions
  • tachykinin receptor activity
  • substance P receptor activity
Processes
  • inflammatory response
  • neuropeptide signaling pathway
  • synaptic transmission
  • positive regulation of smooth muscle contraction
  • cell surface receptor signaling pathway
  • phospholipase C-activating G-protein coupled receptor signaling pathway
  • tachykinin receptor signaling pathway
  • detection of abiotic stimulus
  • regulation of uterine smooth muscle contraction
  • response to pain
Components
  • plasma membrane
  • integral component of plasma membrane
General FunctionTachykinin receptor activity
Specific FunctionThis is a receptor for the tachykinin neuropeptide substance P. It is probably associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance P > substance K > neuromedin-K.
Pfam Domain Function
Transmembrane Regions32-54 65-86 107-128 149-169 195-219 249-270 284-308
GenBank Protein ID8176544
UniProtKB IDP25103
UniProtKB Entry NameNK1R_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010126|Substance-P receptor (TACR1)
ATGGATAACGTCCTCCCGGTGGACTCAGACCTCTCCCCAAACATCTCCACTAACACCTCG
GAACCCAATCAGTTCGTGCAACCAGCCTGGCAAATTGTCCTTTGGGCAGCTGCCTACACG
GTCATTGTGGTGACCTCTGTGGTGGGCAACGTGGTAGTGATGTGGATCATCTTAGCCCAC
AAAAGAATGAGGACAGTGACGAACTATTTTCTGGTGAACCTGGCCTTCGCGGAGGCCTCC
ATGGCTGCATTCAATACAGTGGTGAACTTCACCTATGCTGTCCACAACGAATGGTACTAC
GGCCTGTTCTACTGCAAGTTCCACAACTTCTTTCCCATCGCCGCTGTCTTCGCCAGTATC
TACTCCATGACGGCTGTGGCCTTTGATAGGTACATGGCCATCATACATCCCCTCCAGCCC
CGGCTGTCAGCCACAGCCACCAAAGTGGTCATCTGTGTCATCTGGGTCCTGGCTCTCCTG
CTGGCCTTCCCCCAGGGCTACTACTCAACCACAGAGACCATGCCCAGCAGAGTCGTGTGC
ATGATCGAATGGCCAGAGCATCCGAACAAGATTTATGAGAAAGTGTACCACATCTGTGTG
ACTGTGCTGATCTACTTCCTCCCCCTGCTGGTGATTGGCTATGCATACACCGTAGTGGGA
ATCACACTATGGGCCAGTGAGATCCCCGGGGACTCCTCTGACCGCTACCACGAGCAAGTC
TCTGCCAAGCGCAAGGTGGTCAAAATGATGATTGTCGTGGTGTGCACCTTCGCCATCTGC
TGGCTGCCCTTCCACATCTTCTTCCTCCTGCCCTACATCAACCCAGATCTCTACCTGAAG
AAGTTTATCCAGCAGGTCTACCTGGCCATCATGTGGCTGGCCATGAGCTCCACCATGTAC
AACCCCATCATCTACTGCTGCCTCAATGACAGGTTCCGTCTGGGCTTCAAGCATGCCTTC
CGGTGCTGCCCCTTCATCAGCGCCGGCGACTATGAGGGGCTGGAAATGAAATCCACCCGG
TATCTCCAGACCCAGGGCAGTGTGTACAAAGTCAGCCGCCTGGAGACCACCATCTCCACA
GTGGTGGGGGCCCACGAGGAGGAGCCAGAGGACGGCCCCAAGGCCACACCCTCGTCCCTG
GACCTGACCTCCAACTGCTCTTCACGAAGTGACTCCAAGACCATGACAGAGAGCTTCAGC
TTCTCCTCCAATGTGCTCTCCTAG
GenBank Gene IDS62045
GeneCard IDNot Available
GenAtlas IDTACR1
HGNC IDHGNC:11526
Chromosome Location2
Locus2p13.1
References
  1. Takeda Y, Chou KB, Takeda J, Sachais BS, Krause JE: Molecular cloning, structural characterization and functional expression of the human substance P receptor. Biochem Biophys Res Commun. 1991 Sep 30;179(3):1232-40. 1718267
  2. Hopkins B, Powell SJ, Danks P, Briggs I, Graham A: Isolation and characterisation of the human lung NK-1 receptor cDNA. Biochem Biophys Res Commun. 1991 Oct 31;180(2):1110-7. 1659396
  3. Gerard NP, Garraway LA, Eddy RL Jr, Shows TB, Iijima H, Paquet JL, Gerard C: Human substance P receptor (NK-1): organization of the gene, chromosome localization, and functional expression of cDNA clones. Biochemistry. 1991 Nov 5;30(44):10640-6. 1657150
  4. Takahashi K, Tanaka A, Hara M, Nakanishi S: The primary structure and gene organization of human substance P and neuromedin K receptors. Eur J Biochem. 1992 Mar 15;204(3):1025-33. 1312928
  5. Fong TM, Anderson SA, Yu H, Huang RR, Strader CD: Differential activation of intracellular effector by two isoforms of human neurokinin-1 receptor. Mol Pharmacol. 1992 Jan;41(1):24-30. 1310144
  6. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  7. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. 15815621
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  9. Page NM, Bell NJ: The human tachykinin NK1 (short form) and tachykinin NK4 receptor: a reappraisal. Eur J Pharmacol. 2002 Feb 15;437(1-2):27-30. 11864635
  10. Fong TM, Cascieri MA, Yu H, Bansal A, Swain C, Strader CD: Amino-aromatic interaction between histidine 197 of the neurokinin-1 receptor and CP 96345. Nature. 1993 Mar 25;362(6418):350-3. 8384323
  11. Gayen A, Goswami SK, Mukhopadhyay C: NMR evidence of GM1-induced conformational change of Substance P using isotropic bicelles. Biochim Biophys Acta. 2011 Jan;1808(1):127-39. doi: 10.1016/j.bbamem.2010.09.023. Epub 2010 Oct 16. 20937248
  12. Randolph GP, Simon JS, Arreaza MG, Qiu P, Lachowicz JE, Duffy RA: Identification of single-nucleotide polymorphisms of the human neurokinin 1 receptor gene and pharmacological characterization of a Y192H variant. Pharmacogenomics J. 2004;4(6):394-402. 15452552