You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTumor necrosis factor receptor superfamily member 5
Synonyms
  • B-cell surface antigen CD40
  • Bp50
  • CD40L receptor
  • CDw40
  • TNFRSF5
Gene NameCD40
OrganismHuman
Amino acid sequence
>lcl|BSEQ0002379|Tumor necrosis factor receptor superfamily member 5
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN
KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD
DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Number of residues277
Molecular Weight30618.76
Theoretical pI5.57
GO Classification
Functions
  • enzyme binding
  • antigen binding
  • ubiquitin protein ligase binding
  • tumor necrosis factor-activated receptor activity
  • signal transducer activity
  • receptor activity
Processes
  • cellular response to lipopolysaccharide
  • protein complex assembly
  • cellular calcium ion homeostasis
  • positive regulation of endothelial cell apoptotic process
  • positive regulation of MAP kinase activity
  • positive regulation of protein phosphorylation
  • regulation of immunoglobulin secretion
  • apoptotic signaling pathway
  • regulation of cell proliferation
  • immune response-regulating cell surface receptor signaling pathway
  • positive regulation of protein kinase C signaling
  • tumor necrosis factor-mediated signaling pathway
  • positive regulation of interleukin-12 production
  • cellular response to mechanical stimulus
  • positive regulation of I-kappaB kinase/NF-kappaB signaling
  • regulation of immune response
  • positive regulation of NF-kappaB transcription factor activity
  • positive regulation of B cell proliferation
  • positive regulation of transcription from RNA polymerase II promoter
  • defense response to virus
  • multicellular organismal development
  • B cell proliferation
  • defense response to protozoan
  • response to lipopolysaccharide
  • inflammatory response
  • positive regulation of isotype switching to IgG isotypes
  • positive regulation of GTPase activity
  • positive regulation of tyrosine phosphorylation of Stat1 protein
  • protein kinase B signaling
  • platelet activation
Components
  • extracellular exosome
  • external side of plasma membrane
  • integral component of plasma membrane
  • cytoplasm
  • intracellular membrane-bounded organelle
  • plasma membrane
  • extracellular space
  • cell surface
  • CD40 receptor complex
General FunctionUbiquitin protein ligase binding
Specific FunctionReceptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.
Pfam Domain Function
Transmembrane Regions194-215
GenBank Protein ID29851
UniProtKB IDP25942
UniProtKB Entry NameTNR5_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0016348|Tumor necrosis factor receptor superfamily member 5 (CD40)
ATGGTTCGTCTGCCTCTGCAGTGCGTCCTCTGGGGCTGCTTGCTGACCGCTGTCCATCCA
GAACCACCCACTGCATGCAGAGAAAAACAGTACCTAATAAACAGTCAGTGCTGTTCTTTG
TGCCAGCCAGGACAGAAACTGGTGAGTGACTGCACAGAGTTCACTGAAACGGAATGCCTT
CCTTGCGGTGAAAGCGAATTCCTAGACACCTGGAACAGAGAGACACACTGCCACCAGCAC
AAATACTGCGACCCCAACCTAGGGCTTCGGGTCCAGCAGAAGGGCACCTCAGAAACAGAC
ACCATCTGCACCTGTGAAGAAGGCTGGCACTGTACGAGTGAGGCCTGTGAGAGCTGTGTC
CTGCACCGCTCATGCTCGCCCGGCTTTGGGGTCAAGCAGATTGCTACAGGGGTTTCTGAT
ACCATCTGCGAGCCCTGCCCAGTCGGCTTCTTCTCCAATGTGTCATCTGCTTTCGAAAAA
TGTCACCCTTGGACAAGCTGTGAGACCAAAGACCTGGTTGTGCAACAGGCAGGCACAAAC
AAGACTGATGTTGTCTGTGGTCCCCAGGATCGGCTGAGAGCCCTGGTGGTGATCCCCATC
ATCTTCGGGATCCTGTTTGCCATCCTCTTGGTGCTGGTCTTTATCAAAAAGGTGGCCAAG
AAGCCAACCAATAAGGCCCCCCACCCCAAGCAGGAACCCCAGGAGATCAATTTTCCCGAC
GATCTTCCTGGCTCCAACACTGCTGCTCCAGTGCAGGAGACTTTACATGGATGCCAACCG
GTCACCCAGGAGGATGGCAAAGAGAGTCGCATCTCAGTGCAGGAGAGACAGTGA
GenBank Gene IDX60592
GeneCard IDNot Available
GenAtlas IDCD40
HGNC IDHGNC:11919
Chromosome Location20
Locus20q12-q13.2
References
  1. Stamenkovic I, Clark EA, Seed B: A B-lymphocyte activation molecule related to the nerve growth factor receptor and induced by cytokines in carcinomas. EMBO J. 1989 May;8(5):1403-10. 2475341
  2. Tone M, Tone Y, Fairchild PJ, Wykes M, Waldmann H: Regulation of CD40 function by its isoforms generated through alternative splicing. Proc Natl Acad Sci U S A. 2001 Feb 13;98(4):1751-6. 11172023
  3. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. 11780052
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Braesch-Andersen S, Paulie S, Koho H, Nika H, Aspenstrom P, Perlmann P: Biochemical characteristics and partial amino acid sequence of the receptor-like human B cell and carcinoma antigen CDw40. J Immunol. 1989 Jan 15;142(2):562-7. 2463309
  6. Zhang Z, Henzel WJ: Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 2004 Oct;13(10):2819-24. Epub 2004 Aug 31. 15340161
  7. Khandekar SS, Silverman C, Wells-Marani J, Bacon AM, Birrell H, Brigham-Burke M, DeMarini DJ, Jonak ZL, Camilleri P, Fishman-Lobell J: Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells. Protein Expr Purif. 2001 Nov;23(2):301-10. 11676606
  8. Sato T, Irie S, Reed JC: A novel member of the TRAF family of putative signal transducing proteins binds to the cytosolic domain of CD40. FEBS Lett. 1995 Jan 23;358(2):113-8. 7530216
  9. Cheng G, Cleary AM, Ye ZS, Hong DI, Lederman S, Baltimore D: Involvement of CRAF1, a relative of TRAF, in CD40 signaling. Science. 1995 Mar 10;267(5203):1494-8. 7533327
  10. Pullen SS, Miller HG, Everdeen DS, Dang TT, Crute JJ, Kehry MR: CD40-tumor necrosis factor receptor-associated factor (TRAF) interactions: regulation of CD40 signaling through multiple TRAF binding sites and TRAF hetero-oligomerization. Biochemistry. 1998 Aug 25;37(34):11836-45. 9718306
  11. Mizushima S, Fujita M, Ishida T, Azuma S, Kato K, Hirai M, Otsuka M, Yamamoto T, Inoue J: Cloning and characterization of a cDNA encoding the human homolog of tumor necrosis factor receptor-associated factor 5 (TRAF5). Gene. 1998 Jan 30;207(2):135-40. 9511754
  12. Kashiwada M, Shirakata Y, Inoue JI, Nakano H, Okazaki K, Okumura K, Yamamoto T, Nagaoka H, Takemori T: Tumor necrosis factor receptor-associated factor 6 (TRAF6) stimulates extracellular signal-regulated kinase (ERK) activity in CD40 signaling along a ras-independent pathway. J Exp Med. 1998 Jan 19;187(2):237-44. 9432981
  13. Bajorath J, Aruffo A: Construction and analysis of a detailed three-dimensional model of the ligand binding domain of the human B cell receptor CD40. Proteins. 1997 Jan;27(1):59-70. 9037712
  14. Singh J, Garber E, Van Vlijmen H, Karpusas M, Hsu YM, Zheng Z, Naismith JH, Thomas D: The role of polar interactions in the molecular recognition of CD40L with its receptor CD40. Protein Sci. 1998 May;7(5):1124-35. 9605317
  15. Ni CZ, Welsh K, Leo E, Chiou CK, Wu H, Reed JC, Ely KR: Molecular basis for CD40 signaling mediated by TRAF3. Proc Natl Acad Sci U S A. 2000 Sep 12;97(19):10395-9. 10984535
  16. Li C, Ni CZ, Havert ML, Cabezas E, He J, Kaiser D, Reed JC, Satterthwait AC, Cheng G, Ely KR: Downstream regulator TANK binds to the CD40 recognition site on TRAF3. Structure. 2002 Mar;10(3):403-11. 12005438
  17. Ferrari S, Giliani S, Insalaco A, Al-Ghonaium A, Soresina AR, Loubser M, Avanzini MA, Marconi M, Badolato R, Ugazio AG, Levy Y, Catalan N, Durandy A, Tbakhi A, Notarangelo LD, Plebani A: Mutations of CD40 gene cause an autosomal recessive form of immunodeficiency with hyper IgM. Proc Natl Acad Sci U S A. 2001 Oct 23;98(22):12614-9. 11675497