You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTyrosine-protein phosphatase non-receptor type 3
Synonyms
  • 3.1.3.48
  • Protein-tyrosine phosphatase H1
  • PTP-H1
  • PTPH1
Gene NamePTPN3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009002|Tyrosine-protein phosphatase non-receptor type 3
MTSRLRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVTKQDTGQVLLDMVHN
HLGVTEKEYFGLQHDDDSVDSPRWLEASKAIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSHFIPDQ
NEDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAG
VAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKS
CVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVIGGMVWNPAMRRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
APQDSDSEVSQNRSPHQESLSENNPAQSYLTQKSSSSVSPSSNAPGSCSPDGVDQQLLDD
FHRVTKGGSTEDASQYYCDKNDNGDSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRI
NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRRAVR
SFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGL
AITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGP
LPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCT
IAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLV
HCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
VYEEGLVQMLDPS
Number of residues913
Molecular Weight103989.11
Theoretical pINot Available
GO Classification
Functions
  • phosphotyrosine binding
  • protein tyrosine phosphatase activity
  • ATPase binding
  • sodium channel regulator activity
Processes
  • peptidyl-tyrosine dephosphorylation
  • liver regeneration
  • negative regulation of membrane protein ectodomain proteolysis
  • negative regulation of mitotic cell cycle
  • regulation of membrane depolarization during action potential
  • regulation of sodium ion transmembrane transporter activity
  • protein dephosphorylation
Components
  • cytoplasmic side of plasma membrane
  • cytoplasm
  • cytoskeleton
General FunctionSodium channel regulator activity
Specific FunctionMay act at junctions between the membrane and the cytoskeleton. Possesses tyrosine phosphatase activity.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP26045
UniProtKB Entry NamePTN3_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0013558|Tyrosine-protein phosphatase non-receptor type 3 (PTPN3)
ATGACCTCCCGGTTACGTGCGTTGGGTGGAAGAATTAATAATATACGCACCTCGGAGTTA
CCCAAAGAGAAAACTCGATCAGAAGTCATTTGCAGCATCCACTTTTTAGATGGCGTGGTA
CAGACCTTTAAAGTTACTAAACAAGACACTGGCCAGGTTCTTCTGGATATGGTGCACAAC
CACCTGGGTGTGACTGAAAAGGAATATTTTGGTTTACAGCATGATGACGACTCCGTGGAC
TCTCCTAGATGGCTGGAAGCAAGCAAAGCCATCAGGAAGCAGTTAAAAGGAGGTTTCCCC
TGTACCCTGCATTTTCGAGTAAGATTTTTTATACCTGATCCCAACACACTGCAGCAAGAA
CAAACCAGGCACTTGTATTTCTTACAACTGAAGATGGATATTTGCGAAGGAAGGTTAACC
TGCCCTCTTAACTCAGCAGTGGTTCTAGCGTCCTATGCCGTACAATCTCATTTTGGAGAC
TATAATTCTTCCATACATCATCCAGGCTATCTTTCCGATAGTCACTTTATACCCGATCAA
AATGAGGACTTTTTAACAAAAGTCGAATCTCTGCATGAGCAGCACAGTGGGCTAAAACAA
TCAGAAGCAGAATCCTGCTATATCAACATAGCGCGGACCCTCGACTTCTATGGAGTAGAA
CTGCACAGTGGTAGGGATCTGCACAATTTAGACCTAATGATTGGAATTGCTTCCGCGGGT
GTTGCTGTGTACCGAAAATACATTTGCACAAGTTTCTATCCTTGGGTGAACATTCTCAAA
ATTTCTTTCAAAAGGAAAAAGTTCTTCATACATCAGCGACAGAAACAGGCTGAATCCAGG
GAACATATTGTGGCCTTCAACATGCTGAATTACCGATCTTGCAAAAACTTGTGGAAATCC
TGTGTTGAGCACCATACGTTCTTTCAGGCAAAGAAGCTACTACCTCAGGAAAAGAATGTT
CTGTCTCAGTACTGGACTATGGGCTCTCGGAACACCAAAAAGCGAAGTCCTCGGCTCCGG
CACGAAATCCGAAAGCCACGCCACTCTTCTGCAGATAACCTTGCAAATGAAATGACCTAC
ATCACGGAAACGGAAGATGTATTTTACACGTACAAGGGCTCTCTGGCCCCTCAAGACAGC
GATTCTGAAGTTTCTCAGAACCGAAGCCCGCACCAAGAGAGTTTATCCGAGAACAATCCG
GCACAAAGCTACCTGACCCAGAAGTCATCCAGTTCTGTGTCTCCATCTTCAAATGCTCCA
GGCTCCTGCTCACCTGACGGCGTTGATCAGCAGCTCTTAGATGACTTCCACAGGGTGACC
AAAGGGGGCTCCACCGAGGACGCCAGCCAGTACTACTGTGACAAGAATGATAATGGTGAC
AGCTACTTAGTCTTGATCCGTATCACACCAGATGAAGATGGAAAATTTGGATTTAATCTT
AAGGGAGGAGTGGATCAAAAGATGCCTCTTGTGGTATCAAGGATAAACCCAGAGTCACCT
GCGGACACCTGCATTCCTAAGCTGAACGAAGGGGATCAAATCGTGTTAATCAATGGCCGG
GACATCTCAGAACACACGCATGACCAAGTGGTGATGTTCATCAAAGCCAGCCGGGAGTCC
CACTCACGGGAGCTGGCCCTGGTGATCAGGAGGAGAGCTGTCCGCTCATTTGCTGACTTC
AAGTCTGAAGATGAACTGAACCAGCTTTTCCCCGAAGCCATTTTCCCCATGTGTCCGGAG
GGTGGGGACACTTTGGAGGGATCCATGGCACAGCTAAAGAAGGGCCTCGAAAGCGGGACG
GTGCTGATCCAGTTTGAGCAACTCTACAGAAAAAAGCCAGGTTTGGCCATCACGTTTGCA
AAGCTGCCTCAAAATTTGGACAAAAACCGATATAAAGATGTGCTGCCTTATGACACCACC
CGGGTATTATTGCAGGGAAATGAAGATTATATTAATGCAAGTTACGTGAACATGGAAATT
CCTGCTGCTAACCTTGTGAACAAGTACATCGCCACTCAGGGGCCCCTGCCGCATACCTGT
GCACAGTTTTGGCAGGTTGTCTGGGATCAGAAGTTGTCACTCATTGTCATGTTGACGACT
CTCACAGAACGAGGGCGGACCAAATGTCACCAGTACTGGCCAGATCCCCCCGACGTCATG
AACCACGGCGGCTTTCACATCCAGTGTCAGTCAGAGGACTGCACCATCGCCTATGTGTCC
CGAGAAATGCTGGTCACAAACACCCAGACCGGGGAAGAACACACAGTGACACATCTCCAG
TACGTCGCATGGCCTGACCACGGTGTGCCCGATGACTCCTCCGACTTTCTGGAATTTGTA
AACTATGTGAGGTCTCTGAGAGTGGACAGCGAGCCCGTCCTAGTTCACTGCAGTGCTGGA
ATAGGTCGAACCGGTGTGTTGGTCACTATGGAAACAGCCATGTGCCTAACTGAGAGGAAC
CTGCCCATTTACCCACTGGATATTGTCCGAAAAATGCGAGACCAGCGCGCCATGATGGTG
CAGACATCAAGCCAGTACAAGTTTGTGTGTGAAGCGATTCTTCGTGTGTATGAAGAAGGT
TTAGTCCAAATGCTGGATCCTAGTTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9655
Chromosome Location9
LocusNot Available
References
  1. Yang Q, Tonks NK: Isolation of a cDNA clone encoding a human protein-tyrosine phosphatase with homology to the cytoskeletal-associated proteins band 4.1, ezrin, and talin. Proc Natl Acad Sci U S A. 1991 Jul 15;88(14):5949-53. 1648725
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  3. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. 15164053
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Arimura Y, Hinoda Y, Itoh F, Takekawa M, Tsujisaki M, Adachi M, Imai K, Yachi A: cDNA cloning of new protein tyrosine phosphatases in the human colon. Tumour Biol. 1992;13(3):180-6. 1626183
  6. Ikuta S, Itoh F, Hinoda Y, Toyota M, Makiguchi Y, Imai K, Yachi A: Expression of cytoskeletal-associated protein tyrosine phosphatase PTPH1 mRNA in human hepatocellular carcinoma. J Gastroenterol. 1994 Dec;29(6):727-32. 7874267
  7. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  8. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  9. Barr AJ, Ugochukwu E, Lee WH, King ON, Filippakopoulos P, Alfano I, Savitsky P, Burgess-Brown NA, Muller S, Knapp S: Large-scale structural analysis of the classical human protein tyrosine phosphatome. Cell. 2009 Jan 23;136(2):352-63. doi: 10.1016/j.cell.2008.11.038. 19167335