You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameDNA (cytosine-5)-methyltransferase 1
Synonyms
  • 2.1.1.37
  • AIM
  • CXXC-type zinc finger protein 9
  • CXXC9
  • DNA methyltransferase HsaI
  • DNA MTase HsaI
  • DNMT
  • Dnmt1
  • M.HsaI
  • MCMT
Gene NameDNMT1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0001778|DNA (cytosine-5)-methyltransferase 1
MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQ
LCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENGNQARSEARRV
GMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKP
QEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEK
EEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDEDGDEKDEKKHRSQPKDLAAKRRPE
EKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHPPKCIQCGQYL
DDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGHLC
PIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFS
TSFAEYILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGL
NLNRFTEDSLLRHAQFVVEQVESYDEAGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQAR
RQTIRHSTREKDRGPTKATTTKLVYQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQ
QPECGKCKACKDMVKFGGSGRSKQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQ
GKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVT
ALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPS
ENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLA
EMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPR
KEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNK
FYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGP
NRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLR
TLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMA
GETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRP
RFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAP
GEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNG
ASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLP
NIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCL
PHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFP
DTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD
Number of residues1616
Molecular Weight183163.635
Theoretical pI7.81
GO Classification
Functions
  • zinc ion binding
  • DNA (cytosine-5-)-methyltransferase activity
  • RNA binding
  • DNA-methyltransferase activity
  • DNA binding
  • methyl-CpG binding
  • chromatin binding
Processes
  • chromatin modification
  • DNA methylation on cytosine
  • DNA methylation
  • maintenance of DNA methylation
  • gene silencing
  • negative regulation of gene expression, epigenetic
  • negative regulation of histone H3-K9 methylation
  • gene expression
  • positive regulation of histone H3-K4 methylation
  • regulation of gene expression, epigenetic
  • regulation of cell proliferation
  • cellular response to amino acid stimulus
  • negative regulation of transcription from RNA polymerase II promoter
  • transcription, DNA-templated
  • positive regulation of gene expression
Components
  • nucleus
  • nucleoplasm
  • pericentric heterochromatin
  • replication fork
General FunctionZinc ion binding
Specific FunctionMethylates CpG residues. Preferentially methylates hemimethylated DNA. Associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance. Associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones. Mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID1632819
UniProtKB IDP26358
UniProtKB Entry NameDNMT1_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0010628|DNA (cytosine-5)-methyltransferase 1 (DNMT1)
ATGCCGGCGCGTACCGCCCCAGCCCGGGTGCCCACACTGGCCGTCCCGGCCATCTCGCTG
CCCGACGATGTCCGCAGGCGGCTCAAAGATTTGGAAAGAGACAGCTTAACAGAAAAGGAA
TGTGTGAAGGAGAAATTGAATCTCTTGCACGAATTTCTGCAAACAGAAATAAAGAATCAG
TTATGTGACTTGGAAACCAAATTACGTAAAGAAGAATTATCCGAGGAGGGCTACCTGGCT
AAAGTCAAATCCCTTTTAAATAAAGATTTGTCCTTGGAGAACGGTGCTCATGCTTACAAC
CGGGAAGTGAATGGACGTCTAGAAAACGGGAACCAAGCAAGAAGTGAAGCCCGTAGAGTG
GGAATGGCAGATGCCAACAGCCCCCCCAAACCCCTTTCCAAACCTCGCACGCCCAGGAGG
AGCAAGTCCGATGGAGAGGCTAAGCGTTCAAGAGACCCTCCTGCCTCAGCCTCCCAAGTA
ACTGGGATTAGAGCTGAACCTTCACCTAGCCCCAGGATTACAAGGAAAAGCACCAGGCAA
ACCACCATCACATCTCATTTTGCAAAGGGCCCTGCCAAACGGAAACCTCAGGAAGAGTCT
GAAAGAGCCAAATCGGATGAGTCCATCAAGGAAGAAGACAAAGACCAGGATGAGAAGAGA
CGTAGAGTTACATCCAGAGAACGAGTTGCTAGACCGCTTCCTGCAGAAGAACCTGAAAGA
GCAAAATCAGGAACGCGCACTGAAAAGGAAGAAGAAAGAGATGAAAAAGAAGAAAAGAGA
CTCCGAAGTCAAACCAAAGAACCAACACCCAAACAGAAACTGAAGGAGGAGCCGGACAGA
GAAGCCAGGGCAGGCGTGCAGGCTGACGAGGACGAAGATGGAGACGAGAAAGATGAGAAG
AAGCACAGAAGTCAACCCAAAGATCTAGCTGCCAAACGGAGGCCCGAAGAAAAAGAACCT
GAAAAAGTAAATCCACAGATTTCTGATGAAAAAGACGAGGATGAAAAGGAGGAGAAGAGA
CGCAAAACGACCCCCAAAGAACCAACGGAGAAAAAAATGGCTCGCGCCAAAACAGTCATG
AACTCCAAGACCCACCCTCCCAAGTGCATTCAGTGCGGGCAGTACCTGGACGACCCTGAC
CTCAAATATGGGCAGCACCCACCAGACGCGGTGGATGAGCCACAGATGCTGACAAATGAG
AAGCTGTCCATCTTTGATGCCAACGAGTCTGGCTTTGAGAGTTATGAGGCGCTTCCCCAG
CACAAACTGACCTGCTTCAGTGTGTACTGTAAGCACGGTCACCTGTGTCCCATCGACACC
GGCCTCATCGAGAAGAATATCGAACTCTTCTTTTCTGGTTCAGCAAAACCAATCTATGAT
GATGACCCATCTCTTGAAGGTGGTGTTAATGGCAAAAATCTTGGCCCCATAAATGAATGG
TGGATCACTGGCTTTGATGGAGGTGAAAAGGCCCTCATCGGCTTCAGCACCTCATTTGCC
GAATACATTCTGATGGATCCCAGTCCCGAGTATGCGCCCATATTTGGGCTGATGCAGGAG
AAGATCTACATCAGCAAGATTGTGGTGGAGTTCCTGCAGAGCAATTCCGACTCGACCTAT
GAGGACCTGATCAACAAGATCGAGACCACGGTTCCTCCTTCTGGCCTCAACTTGAACCGC
TTCACAGAGGACTCCCTCCTGCGACACGCGCAGTTTGTGGTGGAGCAGGTGGAGAGTTAT
GACGAGGCCGGGGACAGTGATGAGCAGCCCATCTTCCTGACACCCTGCATGCGGGACCTG
ATCAAGCTGGCTGGGGTCACGCTGGGACAGAGGCGAGCCCAGGCGAGGCGGCAGACCATC
AGGCATTCTACCAGGGAGAAGGACAGGGGACCCACGAAAGCCACCACCACCAAGCTGGTC
TACCAGATCTTCGATACTTTCTTCGCAGAGCAAATTGAAAAGGATGACAGAGAAGACAAG
GAGAACGCCTTTAAGCGCCGGCGATGTGGCGTCTGTGAGGTGTGTCAGCAGCCTGAGTGT
GGGAAATGTAAAGCCTGCAAGGACATGGTTAAATTTGGTGGCAGTGGACGGAGCAAGCAG
GCTTGCCAAGAGCGGAGGTGTCCCAATATGGCCATGAAGGAGGCAGATGACGATGAGGAA
GTCGATGATAACATCCCAGAGATGCCGTCACCCAAAAAAATGCACCAGGGGAAGAAGAAG
AAACAGAACAAGAATCGCATCTCTTGGGTCGGAGAAGCCGTCAAGACTGATGGGAAGAAG
AGTTACTATAAGAAGGTGTGCATTGATGCGGAAACCCTGGAAGTGGGGGACTGTGTCTCT
GTTATTCCAGATGATTCCTCAAAACCGCTGTATCTAGCAAGGGTCACGGCGCTGTGGGAG
GACAGCAGCAACGGGCAGATGTTTCACGCCCACTGGTTCTGCGCTGGGACAGACACAGTC
CTCGGGGCCACGTCGGACCCTCTGGAGCTGTTCTTGGTGGATGAATGTGAGGACATGCAG
CTTTCATATATCCACAGCAAAGTGAAAGTCATCTACAAAGCCCCCTCCGAAAACTGGGCC
ATGGAGGGAGGCATGGATCCCGAGTCCCTGCTGGAGGGGGACGACGGGAAGACCTACTTC
TACCAGCTGTGGTATGATCAAGACTACGCGAGATTCGAGTCCCCTCCAAAAACCCAGCCA
ACAGAGGACAACAAGTTCAAATTCTGTGTGAGCTGTGCCCGTCTGGCTGAGATGAGGCAA
AAAGAAATCCCCAGGGTCCTGGAGCAGCTCGAGGACCTGGATAGCCGGGTCCTCTACTAC
TCAGCCACCAAGAACGGCATCCTGTACCGAGTTGGTGATGGTGTGTACCTGCCCCCTGAG
GCCTTCACGTTCAACATCAAGCTGTCCAGTCCCGTGAAACGCCCACGGAAGGAGCCCGTG
GATGAGGACCTGTACCCAGAGCACTACCGGAAATACTCCGACTACATCAAAGGCAGCAAC
CTGGATGCCCCTGAGCCCTACCGAATTGGCCGGATCAAAGAGATCTTCTGTCCCAAGAAG
AGCAACGGCAGGCCCAATGAGACTGACATCAAAATCCGGGTCAACAAGTTCTACAGGCCT
GAGAACACCCACAAGTCCACTCCAGCGAGCTACCACGCAGACATCAACCTGCTCTACTGG
AGCGACGAGGAGGCCGTGGTGGACTTCAAGGCTGTGCAGGGCCGCTGCACCGTGGAGTAT
GGGGAGGACCTGCCCGAGTGCGTCCAGGTGTACTCCATGGGCGGCCCCAACCGCTTCTAC
TTCCTCGAGGCCTATAATGCAAAGAGCAAAAGCTTTGAAGATCCTCCCAACCATGCCCGT
AGCCCTGGAAACAAAGGGAAGGGCAAGGGAAAAGGGAAGGGCAAGCCCAAGTCCCAAGCC
TGTGAGCCGAGCGAGCCAGAGATAGAGATCAAGCTGCCCAAGCTGCGGACCCTGGATGTG
TTTTCTGGCTGCGGGGGGTTGTCGGAGGGATTCCACCAAGCAGGCATCTCTGACACGCTG
TGGGCCATCGAGATGTGGGACCCTGCGGCCCAGGCGTTCCGGCTGAACAACCCCGGCTCC
ACAGTGTTCACAGAGGACTGCAACATCCTGCTGAAGCTGGTCATGGCTGGGGAGACCACC
AACTCCCGCGGCCAGCGGCTGCCCCAGAAGGGAGACGTGGAGATGCTGTGCGGCGGGCCG
CCCTGCCAGGGCTTCAGCGGCATGAACCGCTTCAATTCGCGCACCTACTCCAAGTTCAAA
AACTCTCTGGTGGTTTCCTTCCTCAGCTACTGCGACTACTACCGGCCCCGGTTCTTCCTC
CTGGAGAATGTCAGGAACTTTGTCTCCTTCAAGCGCTCCATGGTCCTGAAGCTCACCCTC
CGCTGCCTGGTCCGCATGGGCTATCAGTGCACCTTCGGCGTGCTGCAGGCCGGTCAGTAC
GGCGTGGCCCAGACTAGGAGGCGGGCCATCATCCTGGCCGCGGCCCCTGGAGAGAAGCTC
CCTCTGTTCCCGGAGCCACTGCACGTGTTTGCTCCCCGGGCCTGCCAGCTGAGCGTGGTG
GTGGATGACAAGAAGTTTGTGAGCAACATAACCAGGTTGAGCTCGGGTCCTTTCCGGACC
ATCACGGTGCGAGACACGATGTCCGACCTGCCGGAGGTGCGGAATGGAGCCTCGGCACTG
GAGATCTCCTACAACGGGGAGCCTCAGTCCTGGTTCCAGAGGCAGCTCCGGGGCGCACAG
TACCAGCCCATCCTCAGGGACCACATCTGTAAGGACATGAGTGCATTGGTGGCTGCCCGC
ATGCGGCACATCCCCTTGGCCCCAGGGTCAGACTGGCGCGATCTGCCCAACATCGAGGTG
CGGCTCTCAGACGGCACCATGGCCAGGAAGCTGCGGTATACCCACCATGACAGGAAGAAC
GGCCGCAGCAGCTCTGGGGCCCTCCGTGGGGTCTGCTCCTGCGTGGAAGCCGGCAAAGCC
TGCGACCCCGCAGCCAGGCAGTTCAACACCCTCATCCCCTGGTGCCTGCCCCACACCGGG
AACCGGCACAACCACTGGGCTGGCCTCTATGGAAGGCTCGAGTGGGACGGCTTCTTCAGC
ACAACCGTCACCAACCCCGAGCCCATGGGCAAGCAGGGCCGCGTGCTCCACCCAGAGCAG
CACCGTGTGGTGAGCGTGCGGGAGTGTGCCCGCTCCCAGGGCTTCCCTGACACCTACCGG
CTCTTCGGCAACATCCTGGACAAGCACCGGCAGGTGGGCAATGCCGTGCCACCGCCCCTG
GCCAAAGCCATTGGCTTGGAGATCAAGCTTTGTATGTTGGCCAAAGCCCGAGAGAGTGCC
TCAGCTAAAATAAAGGAGGAGGAAGCTGCTAAGGACTAG
GenBank Gene IDX63692
GeneCard IDNot Available
GenAtlas IDDNMT1
HGNC IDHGNC:2976
Chromosome Location19
Locus19p13.2
References
  1. Yen RW, Vertino PM, Nelkin BD, Yu JJ, el-Deiry W, Cumaraswamy A, Lennon GG, Trask BJ, Celano P, Baylin SB: Isolation and characterization of the cDNA encoding human DNA methyltransferase. Nucleic Acids Res. 1992 May 11;20(9):2287-91. 1594447
  2. Yoder JA, Yen RW, Vertino PM, Bestor TH, Baylin SB: New 5' regions of the murine and human genes for DNA (cytosine-5)-methyltransferase. J Biol Chem. 1996 Dec 6;271(49):31092-7. 8940105
  3. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. 15057824
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Hsu DW, Lin MJ, Lee TL, Wen SC, Chen X, Shen CK: Two major forms of DNA (cytosine-5) methyltransferase in human somatic tissues. Proc Natl Acad Sci U S A. 1999 Aug 17;96(17):9751-6. 10449766
  6. Bonfils C, Beaulieu N, Chan E, Cotton-Montpetit J, MacLeod AR: Characterization of the human DNA methyltransferase splice variant Dnmt1b. J Biol Chem. 2000 Apr 14;275(15):10754-60. 10753866
  7. Chuang LS, Ian HI, Koh TW, Ng HH, Xu G, Li BF: Human DNA-(cytosine-5) methyltransferase-PCNA complex as a target for p21WAF1. Science. 1997 Sep 26;277(5334):1996-2000. 9302295
  8. Tatematsu KI, Yamazaki T, Ishikawa F: MBD2-MBD3 complex binds to hemi-methylated DNA and forms a complex containing DNMT1 at the replication foci in late S phase. Genes Cells. 2000 Aug;5(8):677-88. 10947852
  9. Rountree MR, Bachman KE, Baylin SB: DNMT1 binds HDAC2 and a new co-repressor, DMAP1, to form a complex at replication foci. Nat Genet. 2000 Jul;25(3):269-77. 10888872
  10. Robertson KD, Ait-Si-Ali S, Yokochi T, Wade PA, Jones PL, Wolffe AP: DNMT1 forms a complex with Rb, E2F1 and HDAC1 and represses transcription from E2F-responsive promoters. Nat Genet. 2000 Jul;25(3):338-42. 10888886
  11. Robertson KD, Uzvolgyi E, Liang G, Talmadge C, Sumegi J, Gonzales FA, Jones PA: The human DNA methyltransferases (DNMTs) 1, 3a and 3b: coordinate mRNA expression in normal tissues and overexpression in tumors. Nucleic Acids Res. 1999 Jun 1;27(11):2291-8. 10325416
  12. Kim GD, Ni J, Kelesoglu N, Roberts RJ, Pradhan S: Co-operation and communication between the human maintenance and de novo DNA (cytosine-5) methyltransferases. EMBO J. 2002 Aug 1;21(15):4183-95. 12145218
  13. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. 17081983
  14. Vire E, Brenner C, Deplus R, Blanchon L, Fraga M, Didelot C, Morey L, Van Eynde A, Bernard D, Vanderwinden JM, Bollen M, Esteller M, Di Croce L, de Launoit Y, Fuks F: The Polycomb group protein EZH2 directly controls DNA methylation. Nature. 2006 Feb 16;439(7078):871-4. Epub 2005 Dec 14. 16357870
  15. Schlesinger Y, Straussman R, Keshet I, Farkash S, Hecht M, Zimmerman J, Eden E, Yakhini Z, Ben-Shushan E, Reubinoff BE, Bergman Y, Simon I, Cedar H: Polycomb-mediated methylation on Lys27 of histone H3 pre-marks genes for de novo methylation in cancer. Nat Genet. 2007 Feb;39(2):232-6. Epub 2006 Dec 31. 17200670
  16. Pradhan M, Esteve PO, Chin HG, Samaranayke M, Kim GD, Pradhan S: CXXC domain of human DNMT1 is essential for enzymatic activity. Biochemistry. 2008 Sep 23;47(38):10000-9. doi: 10.1021/bi8011725. Epub 2008 Aug 29. 18754681
  17. Sun L, Huang L, Nguyen P, Bisht KS, Bar-Sela G, Ho AS, Bradbury CM, Yu W, Cui H, Lee S, Trepel JB, Feinberg AP, Gius D: DNA methyltransferase 1 and 3B activate BAG-1 expression via recruitment of CTCFL/BORIS and modulation of promoter histone methylation. Cancer Res. 2008 Apr 15;68(8):2726-35. doi: 10.1158/0008-5472.CAN-07-6654. 18413740
  18. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. 18220336
  19. Rathert P, Dhayalan A, Murakami M, Zhang X, Tamas R, Jurkowska R, Komatsu Y, Shinkai Y, Cheng X, Jeltsch A: Protein lysine methyltransferase G9a acts on non-histone targets. Nat Chem Biol. 2008 Jun;4(6):344-6. doi: 10.1038/nchembio.88. Epub 2008 Apr 27. 18438403
  20. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  21. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  22. Lee B, Muller MT: SUMOylation enhances DNA methyltransferase 1 activity. Biochem J. 2009 Jul 15;421(3):449-61. doi: 10.1042/BJ20090142. 19450230
  23. Fellinger K, Rothbauer U, Felle M, Langst G, Leonhardt H: Dimerization of DNA methyltransferase 1 is mediated by its regulatory domain. J Cell Biochem. 2009 Mar 1;106(4):521-8. doi: 10.1002/jcb.22071. 19173286
  24. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  25. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. 19608861
  26. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  27. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  28. Lavoie G, St-Pierre Y: Phosphorylation of human DNMT1: implication of cyclin-dependent kinases. Biochem Biophys Res Commun. 2011 Jun 3;409(2):187-92. doi: 10.1016/j.bbrc.2011.04.115. Epub 2011 May 1. 21565170
  29. Peng L, Yuan Z, Ling H, Fukasawa K, Robertson K, Olashaw N, Koomen J, Chen J, Lane WS, Seto E: SIRT1 deacetylates the DNA methyltransferase 1 (DNMT1) protein and alters its activities. Mol Cell Biol. 2011 Dec;31(23):4720-34. doi: 10.1128/MCB.06147-11. Epub 2011 Sep 26. 21947282
  30. Esteve PO, Chang Y, Samaranayake M, Upadhyay AK, Horton JR, Feehery GR, Cheng X, Pradhan S: A methylation and phosphorylation switch between an adjacent lysine and serine determines human DNMT1 stability. Nat Struct Mol Biol. 2011 Jan;18(1):42-8. doi: 10.1038/nsmb.1939. Epub 2010 Dec 12. 21151116
  31. Felle M, Joppien S, Nemeth A, Diermeier S, Thalhammer V, Dobner T, Kremmer E, Kappler R, Langst G: The USP7/Dnmt1 complex stimulates the DNA methylation activity of Dnmt1 and regulates the stability of UHRF1. Nucleic Acids Res. 2011 Oct;39(19):8355-65. doi: 10.1093/nar/gkr528. Epub 2011 Jul 10. 21745816
  32. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  33. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  34. Syeda F, Fagan RL, Wean M, Avvakumov GV, Walker JR, Xue S, Dhe-Paganon S, Brenner C: The replication focus targeting sequence (RFTS) domain is a DNA-competitive inhibitor of Dnmt1. J Biol Chem. 2011 Apr 29;286(17):15344-51. doi: 10.1074/jbc.M110.209882. Epub 2011 Mar 9. 21389349
  35. Song J, Rechkoblit O, Bestor TH, Patel DJ: Structure of DNMT1-DNA complex reveals a role for autoinhibition in maintenance DNA methylation. Science. 2011 Feb 25;331(6020):1036-40. doi: 10.1126/science.1195380. Epub 2010 Dec 16. 21163962
  36. Klein CJ, Botuyan MV, Wu Y, Ward CJ, Nicholson GA, Hammans S, Hojo K, Yamanishi H, Karpf AR, Wallace DC, Simon M, Lander C, Boardman LA, Cunningham JM, Smith GE, Litchy WJ, Boes B, Atkinson EJ, Middha S, B Dyck PJ, Parisi JE, Mer G, Smith DI, Dyck PJ: Mutations in DNMT1 cause hereditary sensory neuropathy with dementia and hearing loss. Nat Genet. 2011 Jun;43(6):595-600. doi: 10.1038/ng.830. Epub 2011 May 1. 21532572
  37. Winkelmann J, Lin L, Schormair B, Kornum BR, Faraco J, Plazzi G, Melberg A, Cornelio F, Urban AE, Pizza F, Poli F, Grubert F, Wieland T, Graf E, Hallmayer J, Strom TM, Mignot E: Mutations in DNMT1 cause autosomal dominant cerebellar ataxia, deafness and narcolepsy. Hum Mol Genet. 2012 May 15;21(10):2205-10. doi: 10.1093/hmg/dds035. Epub 2012 Feb 9. 22328086