You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMicrotubule-associated protein 4
Synonyms
  • MAP-4
Gene NameMAP4
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037238|Microtubule-associated protein 4
MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNS
ESKKKPCSETSQIEDTPSSKPTLLANGGHGVEGSDTTGSPTEFLEEKMAYQEYPNSQNWP
EDTNFCFQPEQVVDPIQTDPFKMYHDDDLADLVFPSSATADTSIFAGQNDPLKDSYGMSP
CNTAVVPQGWSVEALNSPHSESFVSPEAVAEPPQPTAVPLELAKEIEMASEERPPAQALE
IMMGLKTTDMAPSKETEMALAKDMALATKTEVALAKDMESPTKLDVTLAKDMQPSMESDM
ALVKDMELPTEKEVALVKDVRWPTETDVSSAKNVVLPTETEVAPAKDVTLLKETERASPI
KMDLAPSKDMGPPKENKKETERASPIKMDLAPSKDMGPPKENKIVPAKDLVLLSEIEVAQ
ANDIISSTEISSAEKVALSSETEVALARDMTLPPETNVILTKDKALPLEAEVAPVKDMAQ
LPETEIAPAKDVAPSTVKEVGLLKDMSPLSETEMALGKDVTPPPETEVVLIKNVCLPPEM
EVALTEDQVPALKTEAPLAKDGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKG
ISEDSHLESLQDVGQSAAPTFMISPETVTGTGKKCSLPAEEDSVLEKLGERKPCNSQPSE
LSSETSGIARPEEGRPVVSGTGNDITTPPNKELPPSPEKKTKPLATTQPAKTSTSKAKTQ
PTSLPKQPAPTTIGGLNKKPMSLASGLVPAAPPKRPAVASARPSILPSKDVKPKPIADAK
APEKRASPSKPASAPASRSGSKSTQTVAKTTTAAAVASTGPSSRSPSTLLPKKPTAIKTE
GKPAEVKKMTAKSVPADLSRPKSTSTSSMKKTTTLSGTAPAAGVVPSRVKATPMPSRPST
TPFIDKKPTSAKPSSTTPRLSRLATNTSAPDLKNVRSKVGSTENIKHQPGGGRAKVEKKT
EAAATTRKPESNAVTKTAGPIASAQKQPAGKVQIVSKKVSYSHIQSKCGSKDNIKHVPGG
GNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHL
PAGGAVKTEGGGSEAPLCPGPPAGEEPAISEAAPEAGAPTSASGLNGHPTLSGGGDQREA
QTLDSQIQETSI
Number of residues1152
Molecular Weight121003.805
Theoretical pI5.07
GO Classification
Functions
  • poly(A) RNA binding
  • microtubule binding
  • structural molecule activity
Processes
  • neuron projection development
  • establishment of spindle orientation
  • microtubule sliding
  • mitotic spindle organization
  • cell division
Components
  • neuronal postsynaptic density
  • mitotic spindle
  • cytoplasm
  • microtubule cytoskeleton
  • microtubule
  • plasma membrane
  • microtubule associated complex
  • extracellular exosome
  • neuron projection
General FunctionStructural molecule activity
Specific FunctionNon-neuronal microtubule-associated protein. Promotes microtubule assembly.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP27816
UniProtKB Entry NameMAP4_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0012426|Microtubule-associated protein 4 (MAP4)
ATGGCTGACCTCAGTCTTGCAGATGCATTAACAGAACCATCTCCAGACATTGAGGGAGAG
ATAAAGCGGGACTTCATTGCCACACTAGAGGCAGAGGCCTTTGATGATGTTGTGGGAGAA
ACTGTTGGAAAAACAGACTATATTCCTCTCCTGGATGTTGATGAGAAAACCGGGAACTCA
GAGTCAAAGAAGAAACCGTGCTCAGAAACTAGCCAGATTGAAGATACTCCATCTTCTAAA
CCAACACTCCTAGCCAATGGTGGTCATGGAGTAGAAGGGAGCGATACTACAGGGTCTCCA
ACTGAATTCCTTGAAGAGAAAATGGCCTACCAGGAATACCCAAATAGCCAGAACTGGCCA
GAAGATACCAACTTTTGTTTCCAACCTGAGCAAGTGGTCGATCCTATCCAGACTGATCCC
TTTAAGATGTACCATGATGATGACCTGGCAGATTTGGTCTTTCCCTCCAGTGCGACAGCT
GATACTTCAATATTTGCAGGACAAAATGATCCCTTGAAAGACAGTTACGGTATGTCTCCC
TGCAACACAGCTGTTGTACCTCAGGGGTGGTCTGTGGAAGCCTTAAACTCTCCACACTCA
GAGTCCTTTGTTTCCCCAGAGGCTGTTGCAGAACCTCCTCAGCCAACGGCAGTTCCCTTA
GAGCTAGCCAAGGAGATAGAAATGGCATCAGAAGAGAGGCCACCAGCACAAGCATTGGAA
ATAATGATGGGACTGAAGACTACTGACATGGCACCATCTAAAGAAACAGAGATGGCCCTC
GCCAAGGACATGGCACTAGCTACAAAAACCGAGGTGGCATTGGCTAAAGATATGGAATCA
CCCACCAAATTAGATGTGACACTGGCCAAGGACATGCAGCCATCCATGGAATCAGATATG
GCCCTAGTCAAGGACATGGAACTACCCACAGAAAAAGAAGTGGCCCTGGTTAAGGATGTC
AGATGGCCCACAGAAACAGATGTATCTTCAGCCAAGAATGTGGTACTGCCCACAGAAACA
GAGGTAGCCCCAGCCAAGGATGTGACACTGTTGAAAGAAACAGAGAGGGCATCTCCTATA
AAAATGGACTTAGCCCCTTCCAAGGACATGGGACCACCCAAAGAAAACAAGAAAGAAACA
GAGAGGGCATCTCCTATAAAAATGGACTTGGCTCCTTCCAAGGACATGGGACCACCCAAA
GAAAACAAGATAGTCCCAGCCAAGGATTTGGTATTACTCTCAGAAATAGAGGTGGCACAG
GCTAATGACATTATATCATCCACAGAAATATCCTCTGCTGAGAAGGTGGCTTTGTCCTCA
GAAACAGAGGTAGCCCTGGCCAGGGACATGACACTGCCCCCGGAAACCAACGTGATCTTG
ACCAAGGATAAAGCACTACCTTTAGAAGCAGAGGTGGCCCCAGTCAAGGACATGGCTCAA
CTCCCAGAAACAGAAATAGCCCCGGCCAAGGATGTGGCTCCGTCCACAGTAAAAGAAGTG
GGCTTGTTGAAGGACATGTCTCCACTATCAGAAACAGAAATGGCTCTGGGCAAGGATGTG
ACTCCACCTCCAGAAACAGAAGTAGTTCTCATCAAGAACGTATGTCTGCCTCCAGAAATG
GAGGTGGCCCTGACTGAGGATCAGGTCCCAGCCCTCAAAACAGAAGCACCCCTGGCTAAG
GATGGGGTTCTGACCCTGGCCAACAATGTGACTCCAGCCAAAGATGTTCCACCACTCTCA
GAAACAGAGGCAACACCAGTTCCAATTAAAGACATGGAAATTGCACAAACACAAAAAGGA
ATAAGTGAGGATTCCCATTTAGAATCTCTGCAGGATGTGGGGCAGTCAGCTGCACCTACT
TTCATGATTTCACCAGAAACCGTCACAGGAACGGGGAAAAAGTGCAGCTTGCCGGCCGAG
GAGGATTCTGTGTTAGAAAAACTAGGGGAAAGGAAACCATGCAACAGTCAACCTTCTGAG
CTTTCTTCAGAGACCTCAGGAATAGCCAGGCCAGAAGAAGGAAGGCCTGTGGTGAGTGGG
ACAGGAAATGACATCACCACCCCACCGAACAAGGAGCTCCCACCAAGCCCAGAGAAGAAA
ACAAAGCCTTTGGCCACCACTCAACCTGCAAAGACTTCAACATCGAAAGCCAAAACACAG
CCCACTTCTCTCCCTAAGCAGCCAGCTCCCACCACCATTGGTGGGTTGAATAAAAAACCC
ATGAGCCTTGCTTCAGGCTTAGTGCCAGCTGCCCCACCCAAACGCCCTGCCGTCGCCTCT
GCCAGGCCTTCCATCTTACCTTCAAAAGACGTGAAGCCAAAGCCCATTGCAGATGCAAAG
GCTCCTGAGAAGCGGGCCTCACCATCCAAGCCAGCTTCTGCCCCAGCCTCCAGATCTGGG
TCCAAGAGCACTCAGACTGTTGCAAAAACCACAACAGCTGCTGCTGTTGCCTCAACTGGC
CCAAGCAGTAGGAGCCCCTCCACGCTCCTGCCCAAGAAGCCCACTGCCATTAAGACTGAG
GGAAAACCTGCAGAAGTCAAGAAGATGACTGCAAAGTCTGTACCAGCTGACTTGAGTCGC
CCAAAGAGCACCTCCACCAGTTCCATGAAGAAAACCACCACTCTCAGTGGGACAGCCCCC
GCTGCAGGGGTGGTTCCCAGCCGAGTCAAGGCCACACCCATGCCCTCCCGGCCCTCCACA
ACTCCTTTCATAGACAAGAAGCCCACCTCGGCCAAACCCAGCTCCACCACCCCCCGGCTC
AGCCGCCTGGCCACCAATACTTCTGCTCCTGATCTGAAGAATGTCCGCTCCAAGGTTGGC
TCCACGGAAAACATCAAGCATCAGCCTGGAGGAGGCCGGGCCAAAGTAGAGAAAAAAACA
GAGGCAGCTGCTACAACCCGAAAGCCTGAATCTAATGCAGTCACTAAAACAGCCGGCCCA
ATTGCAAGTGCACAGAAACAACCTGCGGGGAAAGTCCAGATAGTCTCCAAAAAAGTGAGC
TACAGCCATATTCAGTCCAAGTGTGGTTCCAAGGACAATATTAAGCATGTCCCTGGAGGT
GGTAATGTTCAGATTCAGAACAAGAAAGTGGACATCTCTAAGGTCTCCTCCAAGTGTGGG
TCTAAGGCTAACATCAAGCACAAGCCTGGTGGAGGAGATGTCAAGATTGAAAGTCAGAAG
TTGAACTTCAAGGAGAAGGCCCAGGCCAAGGTGGGATCCCTCGATAATGTGGGCCACCTA
CCTGCAGGAGGTGCTGTGAAGATTGAGACCTACAGGCTGACGTTCCGGGCAAATGCCAGG
GCCCGCACCGACCACGGGGCCGACATTGTCTCCCGCCCCCCACACTTCCCTGGCGGCCCC
AACTCGGGCTCCCGGGTCCTTGGCCCCCTTTCCCGGGCTGTCCACTAG
GenBank Gene IDBC015149
GeneCard IDNot Available
GenAtlas IDMAP4
HGNC IDHGNC:6862
Chromosome Location3
LocusNot Available
References
  1. West RR, Tenbarge KM, Olmsted JB: A model for microtubule-associated protein 4 structure. Domains defined by comparisons of human, mouse, and bovine sequences. J Biol Chem. 1991 Nov 15;266(32):21886-96. 1718985
  2. Chapin SJ, Lue CM, Yu MT, Bulinski JC: Differential expression of alternatively spliced forms of MAP4: a repertoire of structurally different microtubule-binding domains. Biochemistry. 1995 Feb 21;34(7):2289-301. 7857940
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. 16641997
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Chapin SJ, Bulinski JC: Non-neuronal 210 x 10(3) Mr microtubule-associated protein (MAP4) contains a domain homologous to the microtubule-binding domains of neuronal MAP2 and tau. J Cell Sci. 1991 Jan;98 ( Pt 1):27-36. 1905296
  7. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  8. Kitazawa H, Iida J, Uchida A, Haino-Fukushima K, Itoh TJ, Hotani H, Ookata K, Murofushi H, Bulinski JC, Kishimoto T, Hisanaga S: Ser787 in the proline-rich region of human MAP4 is a critical phosphorylation site that reduces its activity to promote tubulin polymerization. Cell Struct Funct. 2000 Feb;25(1):33-9. 10791892
  9. Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC: Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry. Anal Chem. 2004 May 15;76(10):2763-72. 15144186
  10. Hillman RT, Green RE, Brenner SE: An unappreciated role for RNA surveillance. Genome Biol. 2004;5(2):R8. Epub 2004 Feb 2. 14759258
  11. Kremer BE, Haystead T, Macara IG: Mammalian septins regulate microtubule stability through interaction with the microtubule-binding protein MAP4. Mol Biol Cell. 2005 Oct;16(10):4648-59. Epub 2005 Aug 10. 16093351
  12. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. 17081983
  13. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. 16964243
  14. Giorgianni F, Zhao Y, Desiderio DM, Beranova-Giorgianni S: Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line. Electrophoresis. 2007 Jun;28(12):2027-34. 17487921
  15. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. 17924679
  16. Tang LY, Deng N, Wang LS, Dai J, Wang ZL, Jiang XS, Li SJ, Li L, Sheng QH, Wu DQ, Li L, Zeng R: Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction. Mol Cell Proteomics. 2007 Nov;6(11):1952-67. Epub 2007 Aug 12. 17693683
  17. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. 18088087
  18. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  19. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  20. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. 19369195
  21. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  22. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  23. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  24. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  25. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. 22814378
  26. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  27. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712