You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
Name5-hydroxytryptamine receptor 1E
Synonyms
  • 5-HT-1E
  • S31
  • Serotonin receptor 1E
Gene NameHTR1E
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010335|5-hydroxytryptamine receptor 1E
MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYL
ICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDR
YWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHV
IYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQ
TFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF
ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIR
CREHT
Number of residues365
Molecular Weight41681.57
Theoretical pI8.98
GO Classification
Functions
  • serotonin binding
  • G-protein coupled receptor activity
  • serotonin receptor activity
Processes
  • G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
  • serotonin receptor signaling pathway
  • adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway
  • negative regulation of cAMP metabolic process
  • synaptic transmission
  • G-protein coupled receptor signaling pathway
Components
  • plasma membrane
  • integral component of plasma membrane
General FunctionSerotonin receptor activity
Specific FunctionG-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various alkaloids and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity.
Pfam Domain Function
Transmembrane Regions23-47 60-82 97-118 139-159 180-202 292-314 325-347
GenBank Protein ID177774
UniProtKB IDP28566
UniProtKB Entry Name5HT1E_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010336|5-hydroxytryptamine receptor 1E (HTR1E)
ATGAACATCACAAACTGTACCACAGAGGCCAGCATGGCTATAAGACCCAAGACCATCACT
GAGAAGATGCTCATTTGCATGACTCTGGTGGTCATCACCACCCTCACCACGTTGCTGAAC
TTGGCTGTGATCATGGCTATTGGCACCACCAAGAAGCTCCACCAGCCTGCCAACTACCTA
ATCTGTTCTCTGGCCGTGACGGACCTCCTGGTGGCAGTGCTCGTCATGCCCCTGAGCATC
ATCTACATTGTCATGGATCGCTGGAAGCTTGGGTACTTCCTCTGTGAGGTGTGGCTGAGT
GTGGACATGACCTGCTGCACCTGCTCCATCCTCCACCTCTGTGTCATTGCCCTGGACAGG
TACTGGGCCATCACCAATGCTATTGAATACGCCAGGAAGAGGACGGCCAAGAGGGCCGCG
CTGATGATCCTTACCGTCTGGACCATCTCCATTTTCATCTCCATGCCCCCTCTGTTCTGG
AGAAGCCACCGCCGCCTAAGCCCTCCCCCTAGTCAGTGCACCATCCAGCACGACCATGTT
ATCTACACCATTTACTCCACGCTGGGTGCGTTTTATATCCCCTTGACTTTGATACTGATT
CTCTATTACCGGATTTACCACGCGGCCAAGAGCCTTTACCAGAAAAGGGGATCAAGTCGG
CACTTAAGCAACAGAAGCACAGATAGCCAGAATTCTTTTGCAAGTTGTAAACTTACACAG
ACTTTCTGTGTGTCTGACTTCTCCACCTCAGACCCTACCACAGAGTTTGAAAAGTTCCAT
GCCTCCATCAGGATCCCCCCCTTCGACAATGATCTAGATCACCCAGGAGAACGTCAGCAG
ATCTCTAGCACCAGGGAACGGAAGGCAGCACGCATCCTGGGGCTGATTCTGGGTGCATTC
ATTTTATCCTGGCTGCCATTTTTCATCAAAGAGTTGATTGTGGGTCTGAGCATCTACACC
GTGTCCTCGGAAGTGGCCGACTTTCTGACGTGGCTCGGTTATGTGAATTCTCTGATCAAC
CCTCTGCTCTATACGAGTTTTAATGAAGACTTTAAGCTGGCTTTTAAAAAGCTCATTAGA
TGCCGAGAGCATACTTAG
GenBank Gene IDM91467
GeneCard IDNot Available
GenAtlas IDHTR1E
HGNC IDHGNC:5291
Chromosome Location6
Locus6q14-q15
References
  1. McAllister G, Charlesworth A, Snodin C, Beer MS, Noble AJ, Middlemiss DN, Iversen LL, Whiting P: Molecular cloning of a serotonin receptor from human brain (5HT1E): a fifth 5HT1-like subtype. Proc Natl Acad Sci U S A. 1992 Jun 15;89(12):5517-21. 1608964
  2. Levy FO, Gudermann T, Birnbaumer M, Kaumann AJ, Birnbaumer L: Molecular cloning of a human gene (S31) encoding a novel serotonin receptor mediating inhibition of adenylyl cyclase. FEBS Lett. 1992 Jan 20;296(2):201-6. 1733778
  3. Zgombick JM, Schechter LE, Macchi M, Hartig PR, Branchek TA, Weinshank RL: Human gene S31 encodes the pharmacologically defined serotonin 5-hydroxytryptamine1E receptor. Mol Pharmacol. 1992 Aug;42(2):180-5. 1513320
  4. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. 14574404
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Kitano T, Liu YH, Ueda S, Saitou N: Human-specific amino acid changes found in 103 protein-coding genes. Mol Biol Evol. 2004 May;21(5):936-44. Epub 2004 Mar 10. 15014171
  7. Bai F, Yin T, Johnstone EM, Su C, Varga G, Little SP, Nelson DL: Molecular cloning and pharmacological characterization of the guinea pig 5-HT1E receptor. Eur J Pharmacol. 2004 Jan 26;484(2-3):127-39. 14744596
  8. Nichols DE, Nichols CD: Serotonin receptors. Chem Rev. 2008 May;108(5):1614-41. doi: 10.1021/cr078224o. Epub 2008 May 14. 18476671
  9. Klein MT, Dukat M, Glennon RA, Teitler M: Toward selective drug development for the human 5-hydroxytryptamine 1E receptor: a comparison of 5-hydroxytryptamine 1E and 1F receptor structure-affinity relationships. J Pharmacol Exp Ther. 2011 Jun;337(3):860-7. doi: 10.1124/jpet.111.179606. Epub 2011 Mar 21. 21422162
  10. Pytliak M, Vargova V, Mechirova V, Felsoci M: Serotonin receptors - from molecular biology to clinical applications. Physiol Res. 2011;60(1):15-25. Epub 2010 Oct 15. 20945968
  11. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. 10391209