You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTyrosine-protein phosphatase non-receptor type 4
Synonyms
  • 3.1.3.48
  • MEG
  • Protein-tyrosine phosphatase MEG1
  • PTPase-MEG1
Gene NamePTPN4
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010687|Tyrosine-protein phosphatase non-receptor type 4
MTSRFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVNKHDQGQVLLDVVFK
HLDLTEQDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPSNTAALLASFAVQSELGDYDQSENLSGYLSDYSFIPNQ
PQDFEKEIAKLHQQHIGLSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEIMIGVMSGG
ILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSISDDRLETQSLPSRSPPGTPNHRNSTFTQEGTRLRPSSVGHLV
DHMVHTSPSEVFVNQRSPSSTQANSIVLESSPSQETPGDGKPPALPPKQSKKNSWNQIHY
SHSQQDLESHINETFDIPSSPEKPTPNGGIPHDNLVLIRMKPDENGRFGFNVKGGYDQKM
PVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLL
VRPNAVYDVVEEKLENEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLTQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSII
NQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQ
VTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNK
RAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YRFVCEAILKVYEEGFVKPLTTSTNK
Number of residues926
Molecular Weight105910.315
Theoretical pI7.47
GO Classification
Functions
  • non-membrane spanning protein tyrosine phosphatase activity
Processes
  • peptidyl-tyrosine dephosphorylation
  • protein dephosphorylation
Components
  • cytoplasmic side of plasma membrane
  • cytoplasm
  • cytoskeleton
General FunctionNon-membrane spanning protein tyrosine phosphatase activity
Specific FunctionMay act at junctions between the membrane and the cytoskeleton.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID190748
UniProtKB IDP29074
UniProtKB Entry NamePTN4_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010688|Tyrosine-protein phosphatase non-receptor type 4 (PTPN4)
ATGACCTCACGTTTCCGATTGCCTGCTGGCAGAACCTACAATGTACGAGCATCAGAGTTG
GCCCGAGACAGACAGCATACTGAAGTGGTTTGCAACATCCTTCTTCTGGATAACACTGTA
CAAGCTTTCAAAGTCAATAAACATGATCAGGGGCAAGTCTTGTTGGATGTCGTCTTCAAG
CATCTAGATTTGACTGAGCAGGACTATTTTGGTTTACAGTTGGCTGATGATTCCACAGAT
AACCCAAGGTGGCTGGATCCAAACAAACCAATAAGGAAGCAGCTAAAGAGAGGATCTCCT
TACAGTTTGAACTTTAGAGTCAAATTTTTTGTAAGTGACCCCAACAAGTTACAAGAAGAA
TATACAAGGTACCAGTATTTTTTGCAAATTAAACAAGACATTCTTACTGGAAGATTACCC
TGTCCTTCTAATACTGCTGCCCTTTTAGCTTCATTTGCTGTTCAGTCTGAACTTGGAGAC
TACGATCAGTCAGAGAACTTGTCAGGCTACCTCTCAGATTATTCTTTCATTCCTAATCAA
CCTCAAGATTTTGAAAAAGAAATTGCAAAATTACATCAGCAACACATAGGCTTATCTCCT
GCAGAAGCAGAATTTAATTACCTAAACACAGCACGTACCTTAGAACTCTATGGAGTTGAA
TTCCACTATGCAAGGGATCAGAGTAACAATGAAATTATGATTGGAGTGATGTCAGGAGGA
ATTCTGATTTATAAGAACAGGGTACGAATGAATACCTTTCCATGGTTGAAGATTGTAAAA
ATTTCTTTTAAGTGCAAACAGTTTTTTATTCAACTTAGAAAAGAATTGCATGAATCTAGA
GAAACATTATTGGGATTTAATATGGTGAATTACAGAGCATGTAAAAATTTGTGGAAAGCA
TGTGTAGAACATCACACATTCTTCCGTTTGGACAGACCACTTCCACCTCAAAAGAATTTT
TTTGCACATTATTTTACATTAGGTTCAAAATTCCGGTACTGTGGGAGAACTGAAGTCCAA
TCAGTTCAGTATGGCAAAGAAAAGGCAAATAAAGACAGGGTATTTGCAAGATCCCCAAGT
AAGCCCTTGGCACGGAAATTAATGGATTGGGAAGTAGTAAGCAGAAATTCAATATCTGAT
GACAGGTTAGAAACACAAAGTCTTCCATCACGATCTCCACCGGGAACTCCTAATCATCGA
AATTCTACATTCACGCAGGAAGGAACCCGGTTACGACCATCTTCAGTTGGTCATTTGGTA
GACCATATGGTTCATACTTCCCCAAGCGAAGTGTTTGTAAATCAGAGATCTCCGTCATCA
ACACAAGCTAATAGCATTGTTCTGGAATCATCACCATCACAAGAGACCCCTGGAGATGGG
AAGCCTCCAGCTTTACCACCCAAACAGTCAAAGAAAAACAGTTGGAACCAAATTCATTAT
TCACATTCGCAACAAGATCTAGAAAGTCATATTAATGAAACATTTGATATTCCATCTTCT
CCTGAAAAACCCACTCCTAATGGTGGTATTCCACATGATAATCTTGTCCTAATCAGAATG
AAACCTGATGAAAATGGGAGGTTTGGATTCAATGTAAAGGGAGGATATGATCAGAAGATG
CCTGTGATTGTGTCTCGAGTAGCACCAGGAACACCTGCTGACCTCTGTGTCCCTAGACTG
AATGAAGGGGACCAAGTTGTACTGATCAATGGTCGGGACATTGCAGAACACACTCATGAT
CAGGTTGTGCTGTTTATTAAAGCTAGTTGTGAGAGACATTCTGGGGAACTCATGCTTCTA
GTTCGACCTAATGCTGTATATGATGTAGTGGAAGAAAAGCTAGAAAATGAGCCAGATTTC
CAGTATATTCCTGAGAAAGCCCCACTAGATAGTGTGCATCAGGATGACCATTCCCTGCGG
GAGTCAATGATCCAGCTAGCTGAGGGGCTTATCACTGGAACAGTCCTGACACAGTTTGAT
CAACTGTATCGGAAAAAACCTGGAATGACAATGTCCTGTGCCAAATTACCTCAGAATATT
TCCAAAAATAGATACAGAGATATTTCGCCTTATGATGCCACACGGGTCATTTTAAAAGGT
AATGAAGACTACATCAATGCGAACTATATAAATATGGAAATTCCTTCTTCCAGCATTATA
AATCAGTACATTGCTTGTCAAGGGCCATTACCACACACTTGTACAGATTTTTGGCAGATG
ACTTGGGAACAAGGCTCCTCTATGGTTGTAATGTTGACCACACAAGTTGAACGTGGCAGA
GTTAAATGTCACCAATATTGGCCAGAACCCACAGGCAGTTCATCTTATGGATGCTACCAA
GTTACCTGCCACTCTGAAGAAGGAAACACTGCCTATATCTTCAGGAAGATGACCCTATTT
AACCAAGAGAAAAATGAAAGTCGTCCACTCACTCAGATCCAGTACATAGCCTGGCCTGAC
CATGGAGTCCCTGATGATTCGAGTGACTTTCTAGATTTTGTTTGTCATGTACGAAACAAG
AGGGCTGGCAAGGAAGAACCCGTTGTTGTCCATTGCAGTGCTGGAATCGGAAGAACTGGG
GTTCTTATTACTATGGAAACAGCCATGTGTCTCATTGAATGCAATCAGCCAGTTTATCCA
CTAGATATTGTAAGAACAATGAGAGATCAGCGAGCCATGATGATCCAAACACCTAGTCAA
TACAGATTTGTATGTGAAGCTATTTTGAAAGTTTATGAAGAAGGCTTTGTTAAACCCTTA
ACAACATCAACAAATAAATAA
GenBank Gene IDM68941
GeneCard IDNot Available
GenAtlas IDPTPN4
HGNC IDHGNC:9656
Chromosome Location2
Locus2q14.2
References
  1. Gu MX, York JD, Warshawsky I, Majerus PW: Identification, cloning, and expression of a cytosolic megakaryocyte protein-tyrosine-phosphatase with sequence homology to cytoskeletal protein 4.1. Proc Natl Acad Sci U S A. 1991 Jul 1;88(13):5867-71. 1648233
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Honda H, Shibuya M, Chiba S, Yazaki Y, Hirai H: Identification of novel protein-tyrosine phosphatases in a human leukemia cell line, F-36P. Leukemia. 1993 May;7(5):742-6. 8483328