You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameM-phase inducer phosphatase 2
Synonyms
  • 3.1.3.48
  • CDC25HU2
  • Dual specificity phosphatase Cdc25B
Gene NameCDC25B
OrganismHuman
Amino acid sequence
>lcl|BSEQ0003381|M-phase inducer phosphatase 2
MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMH
DLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMD
PHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEA
GSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPD
RKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKT
LEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQ
QEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM
VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKR
VILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQ
DYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQDQ
Number of residues580
Molecular Weight64986.745
Theoretical pI6.36
GO Classification
Functions
  • protein tyrosine phosphatase activity
  • protein kinase binding
Processes
  • positive regulation of cytokinesis
  • oocyte maturation
  • positive regulation of protein kinase activity
  • peptidyl-tyrosine dephosphorylation
  • female meiosis I
  • cell division
  • mitotic nuclear division
  • protein phosphorylation
  • positive regulation of cell proliferation
  • G2/M transition of mitotic cell cycle
  • mitotic cell cycle
  • positive regulation of mitotic cell cycle
Components
  • centrosome
  • cytoplasm
  • spindle pole
  • cytosol
  • nucleoplasm
General FunctionProtein tyrosine phosphatase activity
Specific FunctionTyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. Required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. Directly dephosphorylates CDK1 and stimulates its kinase activity. The three isoforms seem to have a different level of activity.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID180173
UniProtKB IDP30305
UniProtKB Entry NameMPIP2_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0003380|1701 bp
ATGGAGGTGCCCCAGCCGGAGCCCGCGCCAGGCTCGGCTCTCAGTCCAGCAGGCGTGTGC
GGTGGCGCCCAGCGTCCGGGCCACCTCCCGGGCCTCCTGCTGGGATCTCATGGCCTCCTG
GGGTCCCCGGTGCGGGCGGCCGCTTCCTCGCCGGTCACCACCCTCACCCAGACCATGCAC
GACCTCGCCGGGCTCGGCAGCCGCAGCCGCCTGACGCACCTATCCCTGTCTCGACGGGCA
TCCGAATCCTCCCTGTCGTCTGAATCCTCCGAATCTTCTGATGCAGGTCTCTGCATGGAT
TCCCCCAGCCCTATGGACCCCCACATGGCGGAGCAGACGTTTGAACAGGCCATCCAGGCA
GCCAGCCGGATCATTCGAAACGAGCAGTTTGCCATCAGACGCTTCCAGTCTATGCCGGTG
AGGCTGCTGGGCCACAGCCCCGTGCTTCGGAACATCACCAACTCCCAGGCGCCCGACGGC
CGGAGGAAGAGCGAGGCGGGCAGTGGAGCTGCCAGCAGCTCTGGGGAAGACAAGGAGAAT
GATGGATTTGTCTTCAAGATGCCATGGAAGCCCACACATCCCAGCTCCACCCATGCTCTG
GCAGAGTGGGCCAGCCGCAGGGAAGCCTTTGCCCAGAGACCCAGCTCGGCCCCCGACCTG
ATGTGTCTCAGTCCTGACCGGAAGATGGAAGTGGAGGAGCTCAGCCCCCTGGCCCTAGGT
CGCTTCTCTCTGACCCCTGCAGAGGGGGATACTGAGGAAGATGATGGATTTGTGGACATC
CTAGAGAGTGACTTAAAGGATGATGATGCAGTTCCCCCAGGCATGGAGAGTCTCATTAGT
GCCCCACTGGTCAAGACCTTGGAAAAGGAAGAGGAAAAGGACCTCGTCATGTACAGCAAG
TGCCAGCGGCTCTTCCGCTCTCCGTCCATGCCCTGCAGCGTGATCCGGCCCATCCTCAAG
AGGCTGGAGCGGCCCCAGGACAGGGACACGCCCGTGCAGAATAAGCGGAGGCGGAGCGTG
ACCCCTCCTGAGGAGCAGCAGGAGGCTGAGGAACCTAAAGCCCGCGTCCTCCGCTCAAAA
TCACTGTGTCACGATGAGATCGAGAACCTCCTGGACAGTGACCACCGAGAGCTGATTGGA
GATTACTCTAAGGCCTTCCTCCTACAGACAGTAGACGGAAAGCACCAAGACCTCAAGTAC
ATCTCACCAGAAACGATGGTGGCCCTATTGACGGGCAAGTTCAGCAACATCGTGGATAAG
TTTGTGATTGTAGACTGCAGATACCCCTATGAATATGAAGGCGGGCACATCAAGACTGCG
GTGAACTTGCCCCTGGAACGCGACGCCGAGAGCTTCCTACTGAAGAGCCCCATCGCGCCC
TGTAGCCTGGACAAGAGAGTCATCCTCATTTTCCACTGTGAATTCTCATCTGAGCGTGGG
CCCCGCATGTGCCGTTTCATCAGGGAACGAGACCGTGCTGTCAACGACTACCCCAGCCTC
TACTACCCTGAGATGTATATCCTGAAAGGCGGCTACAAGGAGTTCTTCCCTCAGCACCCG
AACTTCTGTGAACCCCAGGACTACCGGCCCATGAACCACGAGGCCTTCAAGGATGAGCTA
AAGACCTTCCGCCTCAAGACTCGCAGCTGGGCTGGGGAGCGGAGCCGGCGGGAGCTCTGT
AGCCGGCTGCAGGACCAGTGA
GenBank Gene IDM81934
GeneCard IDNot Available
GenAtlas IDCDC25B
HGNC IDHGNC:1726
Chromosome LocationNot Available
Locus20p13
References
  1. Galaktionov K, Beach D: Specific activation of cdc25 tyrosine phosphatases by B-type cyclins: evidence for multiple roles of mitotic cyclins. Cell. 1991 Dec 20;67(6):1181-94. 1836978
  2. Nagata A, Igarashi M, Jinno S, Suto K, Okayama H: An additional homolog of the fission yeast cdc25+ gene occurs in humans and is highly expressed in some cancer cells. New Biol. 1991 Oct;3(10):959-68. 1662986
  3. Baldin V, Cans C, Superti-Furga G, Ducommun B: Alternative splicing of the human CDC25B tyrosine phosphatase. Possible implications for growth control? Oncogene. 1997 May 22;14(20):2485-95. 9188863
  4. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. 11780052
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Bulavin DV, Higashimoto Y, Popoff IJ, Gaarde WA, Basrur V, Potapova O, Appella E, Fornace AJ Jr: Initiation of a G2/M checkpoint after ultraviolet radiation requires p38 kinase. Nature. 2001 May 3;411(6833):102-7. 11333986
  7. Davezac N, Baldin V, Blot J, Ducommun B, Tassan JP: Human pEg3 kinase associates with and phosphorylates CDC25B phosphatase: a potential role for pEg3 in cell cycle regulation. Oncogene. 2002 Oct 31;21(50):7630-41. 12400006
  8. Lu R, Niida H, Nakanishi M: Human SAD1 kinase is involved in UV-induced DNA damage checkpoint function. J Biol Chem. 2004 Jul 23;279(30):31164-70. Epub 2004 May 18. 15150265
  9. Dutertre S, Cazales M, Quaranta M, Froment C, Trabut V, Dozier C, Mirey G, Bouche JP, Theis-Febvre N, Schmitt E, Monsarrat B, Prigent C, Ducommun B: Phosphorylation of CDC25B by Aurora-A at the centrosome contributes to the G2-M transition. J Cell Sci. 2004 May 15;117(Pt 12):2523-31. Epub 2004 May 5. 15128871
  10. Kramer A, Mailand N, Lukas C, Syljuasen RG, Wilkinson CJ, Nigg EA, Bartek J, Lukas J: Centrosome-associated Chk1 prevents premature activation of cyclin-B-Cdk1 kinase. Nat Cell Biol. 2004 Sep;6(9):884-91. Epub 2004 Aug 15. 15311285
  11. Mirey G, Chartrain I, Froment C, Quaranta M, Bouche JP, Monsarrat B, Tassan JP, Ducommun B: CDC25B phosphorylated by pEg3 localizes to the centrosome and the spindle poles at mitosis. Cell Cycle. 2005 Jun;4(6):806-11. Epub 2005 Jun 5. 15908796
  12. Manke IA, Nguyen A, Lim D, Stewart MQ, Elia AE, Yaffe MB: MAPKAP kinase-2 is a cell cycle checkpoint kinase that regulates the G2/M transition and S phase progression in response to UV irradiation. Mol Cell. 2005 Jan 7;17(1):37-48. 15629715
  13. Schmidt A, Durgan J, Magalhaes A, Hall A: Rho GTPases regulate PRK2/PKN2 to control entry into mitosis and exit from cytokinesis. EMBO J. 2007 Mar 21;26(6):1624-36. Epub 2007 Mar 1. 17332740
  14. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  15. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  16. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  17. Reynolds RA, Yem AW, Wolfe CL, Deibel MR Jr, Chidester CG, Watenpaugh KD: Crystal structure of the catalytic subunit of Cdc25B required for G2/M phase transition of the cell cycle. J Mol Biol. 1999 Oct 29;293(3):559-68. 10543950