You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameM-phase inducer phosphatase 3
Synonyms
  • 3.1.3.48
  • Dual specificity phosphatase Cdc25C
Gene NameCDC25C
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009799|M-phase inducer phosphatase 3
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANL
SILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMK
CSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNP
NLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDK
VKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQ
DLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKK
PIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Number of residues473
Molecular Weight53364.17
Theoretical pINot Available
GO Classification
Functions
  • protein tyrosine phosphatase activity
  • protein kinase binding
  • WW domain binding
Processes
  • viral process
  • DNA replication
  • peptidyl-tyrosine dephosphorylation
  • regulation of cell cycle
  • regulation of cyclin-dependent protein serine/threonine kinase activity
  • small GTPase mediated signal transduction
  • cell division
  • cell proliferation
  • mitotic nuclear division
  • G2/M transition of mitotic cell cycle
  • mitotic cell cycle
  • regulation of mitotic nuclear division
  • spermatogenesis
Components
  • cytosol
  • nucleoplasm
  • perinuclear region of cytoplasm
  • nucleus
General FunctionWw domain binding
Specific FunctionFunctions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP30307
UniProtKB Entry NameMPIP3_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0013921|M-phase inducer phosphatase 3 (CDC25C)
ATGTCTACGGAACTCTTCTCATCCACAAGAGAGGAAGGAAGCTCTGGCTCAGGACCCAGT
TTTAGGTCTAATCAAAGGAAAATGTTAAACCTGCTCCTGGAGAGAGACACTTCCTTTACC
GTCTGTCCAGATGTCCCTAGAACTCCAGTGGGCAAATTTCTTGGTGATTCTGCAAACCTA
AGCATTTTGTCTGGAGGAACCCCAAAACGTTGCCTCGATCTTTCGAATCTTAGCAGTGGG
GAGATAACTGCCACTCAGCTTACCACTTCTGCAGACCTTGATGAAACTGGTCACCTGGAT
TCTTCAGGACTTCAGGAAGTGCATTTAGCTGGGATGAATCATGACCAGCACCTAATGAAA
TGTAGCCCAGCACAGCTTCTTTGTAGCACTCCGAATGGTTTGGACCGTGGCCATAGAAAG
AGAGATGCAATGTGTAGTTCATCTGCAAATAAAGAAAATGACAATGGAAACTTGGTGGAC
AGTGAAATGAAATATTTGGGCAGTCCCATTACTACTGTTCCAAAATTGGATAAAAATCCA
AACCTAGGAGAAGACCAGGCAGAAGAGATTTCAGATGAATTAATGGAGTTTTCCCTGAAA
GATCAAGAAGCAAAGGTGAGCAGAAGTGGCCTATATCGCTCCCCGTCGATGCCAGAGAAC
TTGAACAGGCCAAGACTGAAGCAGGTGGAAAAATTCAAGGACAACACAATACCAGATAAA
GTTAAAAAAAAGTATTTTTCTGGCCAAGGAAAGCTCAGGAAGGGCTTATGTTTAAAGAAG
ACAGTCTCTCTGTGTGACATTACTATCACTCAGATGCTGGAGGAAGATTCTAACCAGGGG
CACCTGATTGGTGATTTTTCCAAGGTATGTGCGCTGCCAACCGTGTCAGGGAAACACCAA
GATCTGAAGTATGTCAACCCAGAAACAGTGGCTGCCTTACTGTCGGGGAAGTTCCAGGGT
CTGATTGAGAAGTTTTATGTCATTGATTGTCGCTATCCATATGAGTATCTGGGAGGACAC
ATCCAGGGAGCCTTAAACTTATATAGTCAGGAAGAACTGTTTAACTTCTTTCTGAAGAAG
CCCATCGTCCCTTTGGACACCCAGAAGAGAATAATCATCGTGTTCCACTGTGAATTCTCC
TCAGAGAGGGGCCCCCGAATGTGCCGCTGTCTGCGTGAAGAGGACAGGTCTCTGAACCAG
TATCCTGCATTGTACTACCCAGAGCTATATATCCTTAAAGGCGGCTACAGAGACTTCTTT
CCAGAATATATGGAACTGTGTGAACCACAGAGCTACTGCCCTATGCATCATCAGGACCAC
AAGACTGAGTTGCTGAGGTGTCGAAGCCAGAGCAAAGTGCAGGAAGGGGAGCGGCAGCTG
CGGGAGCAGATTGCCCTTCTGGTGAAGGACATGAGCCCATGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:1727
Chromosome Location5
LocusNot Available
References
  1. Sadhu K, Reed SI, Richardson H, Russell P: Human homolog of fission yeast cdc25 mitotic inducer is predominantly expressed in G2. Proc Natl Acad Sci U S A. 1990 Jul;87(13):5139-43. 2195549
  2. Bureik M, Rief N, Drescher R, Jungbluth A, Montenarh M, Wagner P: An additional transcript of the cdc25C gene from A431 cells encodes a functional protein. Int J Oncol. 2000 Dec;17(6):1251-8. 11078813
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Wegener S, Hampe W, Herrmann D, Schaller HC: Alternative splicing in the regulatory region of the human phosphatases CDC25A and CDC25C. Eur J Cell Biol. 2000 Nov;79(11):810-5. 11139144
  5. Hernandez S, Bessa X, Bea S, Hernandez L, Nadal A, Mallofre C, Muntane J, Castells A, Fernandez PL, Cardesa A, Campo E: Differential expression of cdc25 cell-cycle-activating phosphatases in human colorectal carcinoma. Lab Invest. 2001 Apr;81(4):465-73. 11304565
  6. Strausfeld U, Fernandez A, Capony JP, Girard F, Lautredou N, Derancourt J, Labbe JC, Lamb NJ: Activation of p34cdc2 protein kinase by microinjection of human cdc25C into mammalian cells. Requirement for prior phosphorylation of cdc25C by p34cdc2 on sites phosphorylated at mitosis. J Biol Chem. 1994 Feb 25;269(8):5989-6000. 8119945
  7. Ouyang B, Li W, Pan H, Meadows J, Hoffmann I, Dai W: The physical association and phosphorylation of Cdc25C protein phosphatase by Prk. Oncogene. 1999 Oct 28;18(44):6029-36. 10557092
  8. Roshak AK, Capper EA, Imburgia C, Fornwald J, Scott G, Marshall LA: The human polo-like kinase, PLK, regulates cdc2/cyclin B through phosphorylation and activation of the cdc25C phosphatase. Cell Signal. 2000 Jun;12(6):405-11. 11202906
  9. Bulavin DV, Higashimoto Y, Popoff IJ, Gaarde WA, Basrur V, Potapova O, Appella E, Fornace AJ Jr: Initiation of a G2/M checkpoint after ultraviolet radiation requires p38 kinase. Nature. 2001 May 3;411(6833):102-7. 11333986
  10. Elia AE, Cantley LC, Yaffe MB: Proteomic screen finds pSer/pThr-binding domain localizing Plk1 to mitotic substrates. Science. 2003 Feb 21;299(5610):1228-31. 12595692
  11. Lu R, Niida H, Nakanishi M: Human SAD1 kinase is involved in UV-induced DNA damage checkpoint function. J Biol Chem. 2004 Jul 23;279(30):31164-70. Epub 2004 May 18. 15150265
  12. Bahassi el M, Hennigan RF, Myer DL, Stambrook PJ: Cdc25C phosphorylation on serine 191 by Plk3 promotes its nuclear translocation. Oncogene. 2004 Apr 8;23(15):2658-63. 14968113
  13. Goh WC, Manel N, Emerman M: The human immunodeficiency virus Vpr protein binds Cdc25C: implications for G2 arrest. Virology. 2004 Jan 5;318(1):337-49. 14972559
  14. Manke IA, Nguyen A, Lim D, Stewart MQ, Elia AE, Yaffe MB: MAPKAP kinase-2 is a cell cycle checkpoint kinase that regulates the G2/M transition and S phase progression in response to UV irradiation. Mol Cell. 2005 Jan 7;17(1):37-48. 15629715
  15. Bonni S, Ganuelas ML, Petrinac S, Hudson JW: Human Plk4 phosphorylates Cdc25C. Cell Cycle. 2008 Feb 15;7(4):545-7. Epub 2007 Nov 25. 18239451
  16. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. 18691976
  17. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  18. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  19. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. 22814378