You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGuanine nucleotide-binding protein subunit alpha-15
Synonyms
  • Epididymis tissue protein Li 17E
  • G alpha-15
  • G alpha-16
  • G-protein subunit alpha-16
  • GNA16
  • Guanine nucleotide-binding protein subunit alpha-16
Gene NameGNA15
OrganismHuman
Amino acid sequence
>lcl|BSEQ0019808|Guanine nucleotide-binding protein subunit alpha-15
MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPGESGKSTFIK
QMRIIHGAGYSEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFSRPESKHHASLVMSQD
PYKVTTFEKRYAAAMQWLWRDAGIRAYYERRREFHLLDSAVYYLSHLERITEEGYVPTAQ
DVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQ
CLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQG
PKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVR
DSVLARYLDEINLL
Number of residues374
Molecular Weight43567.615
Theoretical pINot Available
GO Classification
Functions
  • G-protein beta/gamma-subunit complex binding
  • G-protein coupled receptor binding
  • signal transducer activity
  • GTP binding
  • GTPase activity
  • metal ion binding
Processes
  • phospholipase C-activating G-protein coupled acetylcholine receptor signaling pathway
  • phospholipase C-activating dopamine receptor signaling pathway
  • activation of phospholipase C activity
  • adenylate cyclase-modulating G-protein coupled receptor signaling pathway
  • blood coagulation
  • platelet activation
  • positive regulation of cytosolic calcium ion concentration
Components
  • plasma membrane
  • heterotrimeric G-protein complex
  • cytosol
General FunctionSignal transducer activity
Specific FunctionGuanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP30679
UniProtKB Entry NameGNA15_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0019809|Guanine nucleotide-binding protein subunit alpha-15 (GNA15)
ATGGCCCGCTCGCTGACCTGGCGCTGCTGCCCCTGGTGCCTGACGGAGGATGAGAAGGCC
GCCGCCCGGGTGGACCAGGAGATCAACAGGATCCTCTTGGAGCAGAAGAAGCAGGACCGC
GGGGAGCTGAAGCTGCTGCTTTTGGGCCCAGGCGAGAGCGGGAAGAGCACCTTCATCAAG
CAGATGCGGATCATCCACGGCGCCGGCTACTCGGAGGAGGAGCGCAAGGGCTTCCGGCCC
CTGGTCTACCAGAACATCTTCGTGTCCATGCGGGCCATGATCGAGGCCATGGAGCGGCTG
CAGATTCCATTCAGCAGGCCCGAGAGCAAGCACCACGCTAGCCTGGTCATGAGCCAGGAC
CCCTATAAAGTGACCACGTTTGAGAAGCGCTACGCTGCGGCCATGCAGTGGCTGTGGAGG
GATGCCGGCATCCGGGCCTGCTATGAGCGTCGGCGGGAATTCCACCTGCTCGATTCAGCC
GTGTACTACCTGTCCCACCTGGAGCGCATCACCGAGGAGGGCTACGTCCCCACAGCTCAG
GACGTGCTCCGCAGCCGCATGCCCACCACTGGCATCAACGAGTACTGCTTCTCCGTGCAG
AAAACCAACCTGCGGATCGTGGACGTCGGGGGCCAGAAGTCAGAGCGTAAGAAATGGATC
CATTGTTTCGAGAACGTGATCGCCCTCATCTACCTGGCCTCACTGAGTGAATACGACCAG
TGCCTGGAGGAGAACAACCAGGAGAACCGCATGAAGGAGAGCCTCGCATTGTTTGGGACT
ATCCTGGAACTACCCTGGTTCAAAAGCACATCCGTCATCCTCTTTCTCAACAAAACCGAC
ATCCTGGAGGAGAAAATCCCCACCTCCCACCTGGCTACCTATTTCCCCAGTTTCCAGGGC
CCTAAGCAGGATGCTGAGGCAGCCAAGAGGTTCATCCTGGACATGTACACGAGGATGTAC
ACCGGGTGCGTGGACGGCCCCGAGGGCAGCAAGAAGGGCGCACGATCCCGACGCCTCTTC
AGCCACTACACATGTGCCACAGACACACAGAACATCCGCAAGGTCTTCAAGGACGTGCGG
GACTCGGTGCTCGCCCGCTACCTGGACGAGATCAACCTGCTGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:4383
Chromosome Location19
LocusNot Available
References
  1. Amatruda TT 3rd, Steele DA, Slepak VZ, Simon MI: G alpha 16, a G protein alpha subunit specifically expressed in hematopoietic cells. Proc Natl Acad Sci U S A. 1991 Jul 1;88(13):5587-91. 1905813
  2. Li J, Liu F, Wang H, Liu X, Liu J, Li N, Wan F, Wang W, Zhang C, Jin S, Liu J, Zhu P, Liu Y: Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins. Mol Cell Proteomics. 2010 Nov;9(11):2517-28. doi: 10.1074/mcp.M110.001719. Epub 2010 Aug 24. 20736409
  3. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. 15057824
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  6. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712