You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
Name5-hydroxytryptamine receptor 1F
Synonyms
  • 5-HT-1F
  • HTR1EL
  • Serotonin receptor 1F
Gene NameHTR1F
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010323|5-hydroxytryptamine receptor 1F
MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANY
LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALD
RYRAITDAVEYARKRTPKHAGIMITIVWIISVFISMPPLFWRHQGTSRDDECIIKHDHIV
STIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKS
VSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERKAATTLGLILG
AFVICWLPFFVKELVVNVCDKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQK
LVRCRC
Number of residues366
Molecular Weight41708.505
Theoretical pI9.08
GO Classification
Functions
  • serotonin receptor activity
  • serotonin binding
Processes
  • synaptic transmission
  • G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
  • serotonin receptor signaling pathway
  • adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway
Components
  • plasma membrane
  • integral component of plasma membrane
General FunctionSerotonin receptor activity
Specific FunctionG-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various alkaloids and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity.
Pfam Domain Function
Transmembrane Regions30-50 61-83 98-118 141-161 179-201 291-311 330-350
GenBank Protein ID307420
UniProtKB IDP30939
UniProtKB Entry Name5HT1F_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010324|5-hydroxytryptamine receptor 1F (HTR1F)
ATGGATTTCTTAAATTCATCTGATCAAAACTTGACCTCAGAGGAACTGTTAAACAGAATG
CCATCCAAAATTCTGGTGTCCCTCACTCTGTCTGGGCTGGCACTGATGACAACAACTATC
AACTCCCTTGTGATCGCTGCAATTATTGTGACCCGGAAGCTGCACCATCCAGCCAATTAT
TTAATTTGTTCCCTTGCAGTCACAGATTTTCTTGTGGCTGTCCTGGTGATGCCCTTCAGC
ATTGTGTATATTGTGAGAGAGAGCTGGATTATGGGGCAAGTGGTCTGTGACATTTGGCTG
AGTGTTGACATTACCTGCTGCACGTGCTCCATCTTGCATCTCTCAGCTATAGCTTTGGAT
CGGTATCGAGCAATCACAGATGCTGTTGAGTATGCCAGGAAAAGGACTCCAAAGCATGCT
GGCATTATGATTACAATAGTTTGGATTATATCTGTTTTTATCTCTATGCCTCCTCTATTC
TGGAGGCACCAAGGAACTAGCAGAGATGATGAATGCATCATCAAGCACGACCACATTGTT
TCCACCATTTACTCAACATTTGGAGCTTTCTACATCCCACTGGCATTGATTTTGATCCTT
TACTACAAAATATATAGAGCAGCAAAGACATTATACCACAAGAGACAAGCAAGTAGGATT
GCAAAGGAGGAGGTGAATGGCCAAGTCCTTTTGGAGAGTGGTGAGAAAAGCACTAAATCA
GTTTCCACATCCTATGTACTAGAAAAGTCTTTATCTGACCCATCAACAGACTTTGATAAA
ATTCATAGCACAGTGAGAAGTCTCAGGTCTGAATTCAAGCATGAGAAATCTTGGAGAAGG
CAAAAGATCTCAGGTACAAGAGAACGGAAAGCAGCCACTACCCTGGGATTAATCTTGGGT
GCATTTGTAATATGTTGGCTTCCTTTTTTTGTAAAAGAATTAGTTGTTAATGTCTGTGAC
AAATGTAAAATTTCTGAAGAAATGTCCAATTTTTTGGCATGGCTTGGGTATCTCAATTCC
CTTATAAATCCACTGATTTACACAATCTTTAATGAAGACTTCAAGAAAGCATTCCAAAAG
CTTGTGCGATGTCGATGTTAG
GenBank Gene IDL05597
GeneCard IDNot Available
GenAtlas IDHTR1F
HGNC IDHGNC:5292
Chromosome Location3
Locus3p12
References
  1. Lovenberg TW, Erlander MG, Baron BM, Racke M, Slone AL, Siegel BW, Craft CM, Burns JE, Danielson PE, Sutcliffe JG: Molecular cloning and functional expression of 5-HT1E-like rat and human 5-hydroxytryptamine receptor genes. Proc Natl Acad Sci U S A. 1993 Mar 15;90(6):2184-8. 8384716
  2. Adham N, Kao HT, Schecter LE, Bard J, Olsen M, Urquhart D, Durkin M, Hartig PR, Weinshank RL, Branchek TA: Cloning of another human serotonin receptor (5-HT1F): a fifth 5-HT1 receptor subtype coupled to the inhibition of adenylate cyclase. Proc Natl Acad Sci U S A. 1993 Jan 15;90(2):408-12. 8380639
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. 16641997
  5. Nichols DE, Nichols CD: Serotonin receptors. Chem Rev. 2008 May;108(5):1614-41. doi: 10.1021/cr078224o. Epub 2008 May 14. 18476671
  6. Klein MT, Dukat M, Glennon RA, Teitler M: Toward selective drug development for the human 5-hydroxytryptamine 1E receptor: a comparison of 5-hydroxytryptamine 1E and 1F receptor structure-affinity relationships. J Pharmacol Exp Ther. 2011 Jun;337(3):860-7. doi: 10.1124/jpet.111.179606. Epub 2011 Mar 21. 21422162
  7. Pytliak M, Vargova V, Mechirova V, Felsoci M: Serotonin receptors - from molecular biology to clinical applications. Physiol Res. 2011;60(1):15-25. Epub 2010 Oct 15. 20945968