You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameCholecystokinin receptor type A
Synonyms
  • CCK-A receptor
  • CCK1-R
  • CCKRA
  • Cholecystokinin-1 receptor
Gene NameCCKAR
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010278|Cholecystokinin receptor type A
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS
SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY
TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH
MSASVPPQ
Number of residues428
Molecular Weight47840.645
Theoretical pI9.48
GO Classification
Functions
  • peptide binding
  • cholecystokinin receptor activity
Processes
  • gastric acid secretion
  • phospholipase C-activating G-protein coupled receptor signaling pathway
  • organ regeneration
  • response to glucocorticoid
  • actin cytoskeleton reorganization
  • cholecystokinin signaling pathway
  • feeding behavior
  • cellular response to hormone stimulus
  • insulin secretion
  • response to lipopolysaccharide
  • neuron migration
  • regulation of calcium ion transport
  • pancreas development
  • axonogenesis
  • pancreatic juice secretion
  • response to peptide
  • positive regulation of somatostatin secretion
  • response to nutrient
  • reduction of food intake in response to dietary excess
  • forebrain development
  • regulation of hormone secretion
  • response to starvation
  • response to radiation
  • regulation of potassium ion transport
  • digestion
  • temperature homeostasis
  • response to heat
  • positive regulation of cytosolic calcium ion concentration
Components
  • integral component of plasma membrane
  • endosome
  • endoplasmic reticulum
  • plasma membrane
  • lysosome
  • terminal bouton
  • cytosol
General FunctionPeptide binding
Specific FunctionReceptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Pfam Domain Function
Transmembrane Regions42-67 78-104 116-137 158-178 211-234 314-334 350-373
GenBank Protein ID306491
UniProtKB IDP32238
UniProtKB Entry NameCCKAR_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010279|Cholecystokinin receptor type A (CCKAR)
ATGGATGTGGTTGACAGCCTTCTTGTGAATGGAAGCAACATCACTCCTCCCTGTGAACTC
GGGCTCGAAAATGAGACGCTTTTCTGCTTGGATCAGCCCCGTCCTTCCAAAGAGTGGCAG
CCAGCGGTGCAGATTCTCTTGTACTCCTTGATATTCCTGCTCAGCGTGCTGGGAAACACG
CTGGTCATCACCGTGCTGATTCGGAACAAGCGGATGCGGACGGTCACCAACATCTTCCTC
CTCTCCCTGGCTGTCAGCGACCTCATGCTCTGTCTCTTCTGCATGCCGTTCAACCTCATC
CCCAATCTGCTCAAGGATTTCATCTTCGGGAGCGCCGTTTGCAAGACCACCACCTACTTC
ATGGGCACCTCTGTGAGTGTATCTACCTTTAATCTGGTAGCCATATCTCTAGAGAGATAT
GGTGCGATTTGCAAACCCTTACAGTCCCGGGTCTGGCAGACAAAATCCCATGCTTTGAAG
GTGATTGCTGCTACCTGGTGCCTTTCCTTTACCATCATGACTCCGTACCCCATTTATAGC
AACTTGGTGCCTTTTACCAAAAATAACAACCAGACCGCGAATATGTGCCGCTTTCTACTG
CCAAATGATGTTATGCAGCAGTCCTGGCACACATTCCTGTTACTCATCCTCTTTCTTATT
CCTGGAATTGTGATGATGGTGGCATATGGATTAATCTCTTTGGAACTCTACCAGGGAATA
AAATTTGAGGCTAGCCAGAAGAAGTCTGCTAAAGAAAGGAAACCTAGCACCACCAGCAGC
GGCAAATATGAGGACAGCGATGGGTGTTACCTGCAAAAGACCAGGCCCCCGAGGAAGCTG
GAGCTCCGGCAGCTGTCCACCGGCAGCAGCAGCAGGGCCAACCGCATCCGGAGTAACAGC
TCCGCAGCCAACCTGATGGCCAAGAAAAGGGTGATCCGCATGCTCATCGTCATCGTGGTC
CTCTTCTTCCTGTGCTGGATGCCCATCTTCAGCGCCAACGCCTGGCGGGCCTACGACACC
GCCTCCGCAGAGCGCCGCCTCTCAGGAACCCCCATTTCCTTCATCCTCCTCCTGTCCTAC
ACCTCCTCCTGCGTCAACCCCATCATCTACTGCTTCATGAACAAACGCTTCCGCCTCGGC
TTCATGGCCACCTTCCCCTGCTGCCCCAATCCTGGTCCCCCAGGGGCGAGGGGAGAGGTG
GGGGAGGAGGAGGAAGGCGGGACCACAGGAGCCTCTCTGTCCAGGTTCTCGTACAGCCAT
ATGAGTGCCTCGGTGCCACCCCAGTGA
GenBank Gene IDL13605
GeneCard IDNot Available
GenAtlas IDCCKAR
HGNC IDHGNC:1570
Chromosome Location4
Locus4p15.1-p15.2
References
  1. Ulrich CD, Ferber I, Holicky E, Hadac E, Buell G, Miller LJ: Molecular cloning and functional expression of the human gallbladder cholecystokinin A receptor. Biochem Biophys Res Commun. 1993 May 28;193(1):204-11. 8503909
  2. de Weerth A, Pisegna JR, Huppi K, Wank SA: Molecular cloning, functional expression and chromosomal localization of the human cholecystokinin type A receptor. Biochem Biophys Res Commun. 1993 Jul 30;194(2):811-8. 8343165
  3. Miller LJ, Holicky EL, Ulrich CD, Wieben ED: Abnormal processing of the human cholecystokinin receptor gene in association with gallstones and obesity. Gastroenterology. 1995 Oct;109(4):1375-80. 7557108
  4. Funakoshi A, Miyasaka K, Matsumoto H, Yamamori S, Takiguchi S, Kataoka K, Takata Y, Matsusue K, Kono A, Shimokata H: Gene structure of human cholecystokinin (CCK) type-A receptor: body fat content is related to CCK type-A receptor gene promoter polymorphism. FEBS Lett. 2000 Jan 28;466(2-3):264-6. 10682840
  5. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  7. Pellegrini M, Mierke DF: Molecular complex of cholecystokinin-8 and N-terminus of the cholecystokinin A receptor by NMR spectroscopy. Biochemistry. 1999 Nov 9;38(45):14775-83. 10555959
  8. Giragossian C, Mierke DF: Intermolecular interactions between cholecystokinin-8 and the third extracellular loop of the cholecystokinin A receptor. Biochemistry. 2001 Apr 3;40(13):3804-9. 11300760